Recombinant Bacillus cereus UPF0059 membrane protein BCQ_5165 (BCQ_5165)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format that we have in stock. However, if you have any specific format requirements, please specify them in your order notes, and we will accommodate your request.
Lead Time
Delivery time may vary depending on the purchase method and location. Please contact your local distributors for specific delivery timeframes.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance. Additional fees may apply.
Notes
Repeated freezing and thawing is not recommended. For optimal preservation, store working aliquots at 4°C for up to one week.
Reconstitution
Prior to opening, we recommend briefly centrifuging the vial to ensure the contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers can use this as a reference.
Shelf Life
The shelf life is influenced by various factors, including storage conditions, buffer composition, temperature, and the intrinsic stability of the protein.
Generally, the shelf life of the liquid form is 6 months at -20°C/-80°C. The shelf life of the lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is determined during the production process. If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
mntP; BCQ_5165; Putative manganese efflux pump MntP
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-182
Protein Length
full length protein
Species
Bacillus cereus (strain Q1)
Target Names
mntP
Target Protein Sequence
MTFEQLIPLIIMAFALGMDAFSVSLGMGMMALKIRQILYIGVTIGIFHIIMPFIGMVLGR FLSEQYGDIAHFAGAILLIGLGFYIVYSSILENEETRTAPIGISLFVFAFGVSIDSFSVG LSLGIYGAQTVITILLFGFISMLLAWTGLFIGRHAKGMLGTYGEIVGGIILVGFGLYLLF PI
Uniprot No.

Target Background

Function
This protein is likely to function as a manganese efflux pump.
Database Links

KEGG: bcq:BCQ_5165

Protein Families
MntP (TC 9.B.29) family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

How should BCQ_5165 recombinant protein be stored and reconstituted for experimental use?

For optimal preservation of BCQ_5165 protein structure and function, follow these storage protocols:

  • Store the lyophilized powder at -20°C to -80°C upon receipt

  • Aliquot the protein to avoid repeated freeze-thaw cycles

  • Working aliquots may be stored at 4°C for up to one week

  • The protein is typically stored in Tris/PBS-based buffer with 6% Trehalose, pH 8.0

For reconstitution:

  • Briefly centrifuge the vial before opening

  • Reconstitute in deionized sterile water to a concentration of 0.1-1.0 mg/mL

  • Add glycerol to a final concentration of 5-50% (commonly 50%) for long-term storage

  • Aliquot and store at -20°C/-80°C

Repeated freeze-thaw cycles should be avoided as they can compromise protein integrity and biological activity.

How does BCQ_5165 differ between spore and vegetative cellular membranes of Bacillus cereus?

Quantitative proteomics studies of B. cereus membrane proteins have revealed significant differences in protein composition between spore inner membranes and vegetative cell membranes:

ParameterSpore Inner MembraneVegetative Cell Membrane
Total identified membrane proteins244498
Specific membrane proteins54308
TransportersLimited (primarily for simple carbohydrates)Numerous and diverse
Specialized functionsGerminant receptors, spore-specific proteinsCell division, motility proteins

While membrane proteins like BCQ_5165 may be present in both states, expression levels and functional significance can differ substantially between the dormant spore state and actively growing vegetative cells. Spore inner membranes appear to maintain a more specialized and limited proteome focused on survival and germination functions, while vegetative cell membranes support more diverse metabolic and environmental interaction functions .

What experimental design considerations are critical when studying BCQ_5165 functional properties?

When designing experiments to investigate BCQ_5165 functional properties, researchers should implement a robust Design of Experiments (DOE) approach:

  • Factor Identification and Level Selection:

    • Primary factors: protein concentration, buffer composition, temperature, pH

    • Consider secondary factors: presence of potential interacting proteins, metal ions (particularly manganese)

    • Set appropriate factor levels based on physiologically relevant ranges

  • Design Selection:

    • For initial screening of critical factors: fractional factorial design

    • For detailed characterization: full factorial design with replication

    • Consider blocking to control for batch-to-batch variability

  • Response Variable Selection:

    • Primary: Transport activity, binding affinity, structural stability

    • Secondary: Oligomerization state, conformational changes

  • Error Reduction Strategies:

    • Implement technical replicates to reduce measurement error

    • Use biological replicates to account for expression system variability

    • Control systematic errors through appropriate controls and randomization

  • Analysis Approach:

    • ANOVA for identifying significant factors and interactions

    • Response surface methodology for optimization of conditions

How can researchers effectively isolate and purify BCQ_5165 while maintaining native structure and function?

Isolating membrane proteins such as BCQ_5165 presents unique challenges due to their hydrophobic nature. The following methodological approach optimizes purification while preserving structural integrity:

  • Expression System Optimization:

    • E. coli is the established system for BCQ_5165 expression

    • Consider BL21(DE3) or C41(DE3) strains specifically engineered for membrane protein expression

    • Optimize induction conditions: lower temperatures (16-18°C) and reduced IPTG concentrations often improve membrane protein folding

  • Membrane Extraction Protocol:

    • Cell disruption: sonication or French press in buffer containing protease inhibitors

    • Differential centrifugation to isolate membrane fractions (30,000-100,000 × g)

    • Solubilization using mild detergents (recommended starting panel):

    DetergentCritical Micelle ConcentrationMembrane Protein Compatibility
    n-Dodecyl-β-D-maltoside (DDM)0.17 mMHigh, preserves function
    n-Octyl-β-D-glucopyranoside (OG)20-25 mMModerate-high
    Lauryl maltose neopentyl glycol (LMNG)0.01 mMHigh, stabilizing
    Digitonin0.5 mMVery high for sensitive proteins
  • Affinity Purification Strategy:

    • Utilize the N-terminal His-tag for IMAC (immobilized metal affinity chromatography)

    • Implement a step gradient elution to separate populations

    • Consider detergent exchange during purification if initial detergent is not optimal for downstream applications

  • Quality Control Assessment:

    • Size exclusion chromatography to verify monodispersity

    • Circular dichroism to confirm secondary structure retention

    • Activity assays specific to manganese transport function

This methodological framework provides a starting point that can be optimized based on specific research objectives and available equipment.

What are the current hypotheses regarding BCQ_5165 function in manganese homeostasis, and how can they be tested?

  • Active Transport Hypothesis:

    • BCQ_5165 directly exports excess Mn²⁺ using energy from proton motive force

    • Testing approach: Reconstitute purified BCQ_5165 in proteoliposomes and measure Mn²⁺ transport against a concentration gradient in the presence and absence of protonophores

  • Facilitated Diffusion Hypothesis:

    • BCQ_5165 forms a channel allowing Mn²⁺ to exit the cell along concentration gradients

    • Testing approach: Patch-clamp electrophysiology of BCQ_5165 in artificial bilayers with varying Mn²⁺ concentrations

  • Metal Selectivity Hypothesis:

    • BCQ_5165 has specificity for Mn²⁺ but may transport other divalent cations

    • Testing approach: Competitive transport assays with various metal ions (Zn²⁺, Fe²⁺, Ca²⁺, Mg²⁺)

  • Regulatory Interaction Hypothesis:

    • BCQ_5165 function is modulated by interaction with other proteins in the membrane

    • Testing approach: Pull-down assays and crosslinking studies to identify interaction partners, followed by co-expression studies to assess functional impacts

Each hypothesis requires careful experimental design with appropriate controls and should utilize both in vitro reconstituted systems and in vivo approaches in B. cereus.

What strategies can be employed to study the membrane topology and structural features of BCQ_5165?

Determining membrane protein topology is essential for understanding BCQ_5165 function. Multiple complementary approaches should be implemented:

  • Computational Prediction Methods:

    • Hydropathy analysis and transmembrane domain prediction using algorithms like TMHMM, TOPCONS, and Phobius

    • Secondary structure prediction using PSIPRED or JPred

    • Analysis of the BCQ_5165 sequence indicates multiple transmembrane domains characteristic of transporter proteins

  • Biochemical Mapping Techniques:

    • Cysteine scanning mutagenesis: systematically replace residues with cysteine and probe accessibility with membrane-permeable and impermeable thiol reagents

    • Protease protection assays: limited proteolysis of BCQ_5165 in native membranes or proteoliposomes

  • Fluorescence-Based Approaches:

    • FRET (Förster Resonance Energy Transfer) between labeled domains to determine proximity

    • Site-directed fluorescence labeling to probe environmental sensitivity

  • Structural Biology Techniques:

    TechniqueResolutionSample RequirementsAdvantagesLimitations
    X-ray CrystallographyAtomicCrystals of purified proteinHighest resolutionDifficult to crystallize membrane proteins
    Cryo-EMNear-atomicPurified proteinWorks with smaller amounts, no crystals neededRequires stable protein prep
    NMR SpectroscopyAtomicIsotopically labeled proteinCan capture dynamicsSize limitations
    EPR SpectroscopyMediumSpin-labeled proteinWorks in native-like environmentsLimited resolution
  • Cross-linking Mass Spectrometry:

    • Chemical cross-linking of neighboring residues followed by mass spectrometric identification

    • Helps establish distance constraints for structural modeling

Implementation of these techniques in combination provides robust validation of structural models and reveals important functional domains of BCQ_5165.

How can researchers effectively design experiments to study BCQ_5165 interactions with other membrane components in Bacillus cereus?

Studying protein-protein and protein-lipid interactions of membrane proteins requires specialized approaches:

  • In vivo Interaction Mapping:

    • Bacterial two-hybrid systems adapted for membrane proteins

    • FRET-based assays with fluorescently tagged potential partners

    • In vivo crosslinking with photo-activatable or chemical crosslinkers

  • Membrane Mimetic Systems:

    • Nanodiscs: BCQ_5165 reconstitution in lipid bilayers stabilized by scaffold proteins

    • Bicelles or lipodisqs: disc-shaped bilayer systems suitable for spectroscopic studies

    • Proteoliposomes with controlled lipid composition

  • Experimental Design Considerations:

    • Factorial design approach to test multiple interaction candidates simultaneously

    • Control for expression level variations using quantitative Western blotting

    • Consider membrane microdomain distributions via detergent resistance assays

  • Detection Methods:

    MethodPrincipleAdvantagesLimitations
    Co-immunoprecipitationAntibody-based pulldownCan detect native interactionsRequires specific antibodies
    Tandem affinity purificationSequential affinity tagsReduces false positivesMay disrupt weak interactions
    Bimolecular fluorescence complementationSplit fluorophore reconstitutionVisualizes interactions in situIrreversible assembly
    MASS spectrometryIdentification of co-purifying proteinsUnbiased, comprehensiveMay include nonspecific interactions
  • Validation Strategies:

    • Mutational analysis of putative interaction interfaces

    • Competition assays with peptides derived from interaction domains

    • Correlation of interaction with functional assays

When comparing spore and vegetative cell membranes, these techniques can reveal differential interaction networks that explain the functional adaptations of BCQ_5165 in different cellular states .

What are the most effective approaches for investigating the role of BCQ_5165 in manganese homeostasis using genetic manipulation techniques?

Genetic manipulation provides powerful tools for understanding BCQ_5165 function in vivo:

  • Gene Knockout/Knockdown Strategies:

    • CRISPR-Cas9 genome editing for precise deletion of BCQ_5165

    • Antisense RNA approaches for conditional depletion

    • Design considerations:

      • Include controls for polar effects on adjacent genes

      • Verify knockout by PCR, RT-PCR, and Western blotting

      • Assess growth phenotypes under varying manganese concentrations

  • Complementation and Overexpression Systems:

    • Reintroduction of BCQ_5165 under native or inducible promoters

    • Expression of BCQ_5165 variants with point mutations in key residues

    • Experimental design:

      • Use plasmids with appropriate copy number control

      • Include epitope tags that don't interfere with function

      • Test complementation under multiple stress conditions

  • Reporter Fusion Constructs:

    • Transcriptional fusions (promoter-reporter) to study regulation

    • Translational fusions to monitor protein localization and levels

    • Split reporter systems to monitor conformational changes

  • Phenotypic Characterization Matrix:

    ConditionMeasurementExpected Outcome in BCQ_5165 Mutant
    High Mn²⁺Growth rateDecreased growth due to manganese toxicity
    High Mn²⁺Intracellular Mn²⁺Elevated levels compared to wild-type
    Oxidative stressSurvivalIncreased sensitivity
    Spore formationEfficiencyPotentially altered sporulation
    Metal competitionGrowth with Zn/Fe limitationAltered metal-dependent phenotypes
  • Transcriptomic and Proteomic Analysis:

    • RNA-Seq to identify compensatory responses to BCQ_5165 deletion

    • Quantitative proteomics to measure changes in membrane proteome composition

    • Analysis should compare vegetative cells and sporulating cultures to capture state-specific effects

These genetic approaches should be combined with biochemical validation to establish causality between genotype and phenotype.

How should researchers approach conflicting data when studying BCQ_5165 function across different experimental systems?

When faced with conflicting results regarding BCQ_5165 function, implement a systematic approach to resolve discrepancies:

  • Experimental System Comparison Framework:

    • Catalog key differences between experimental systems (expression host, purification method, membrane mimetic)

    • Evaluate how these differences might impact protein function

    • Design bridging experiments that systematically vary single parameters

  • Statistical Validation Approach:

    • Implement robust statistical methods appropriate for each experiment type

    • For DOE-based experiments, use ANOVA with appropriate post-hoc tests

    • Calculate effect sizes to determine biological significance beyond statistical significance

  • Triangulation Strategy:

    • Deploy orthogonal methodologies to address the same hypothesis

    • Combine in vitro biochemical, in vivo genetic, and in silico computational approaches

    • Assess consistency across methodologies rather than relying on any single approach

  • Common Sources of Discrepancies and Solutions:

    Source of ConflictInvestigation ApproachResolution Strategy
    Tag interferenceCompare tagged vs. untagged proteinsUse cleavable tags or multiple tag positions
    Lipid environment differencesSystematic lipid composition analysisReconstitute in native-like lipid environments
    Post-translational modificationsMS analysis of protein from native vs. recombinant sourcesExpress in more native-like systems if needed
    Oligomerization state differencesSEC-MALS, native PAGE, crosslinking studiesEnsure proper assembly in functional assays
    Strain-specific effectsCompare multiple B. cereus strainsFocus on conserved functions across strains
  • Integration Framework:

    • Develop a hierarchical model that accommodates seemingly conflicting data

    • Consider how cellular context (vegetative vs. spore) affects protein function

    • Propose testable hypotheses that would explain observed discrepancies

This structured approach transforms conflicting data from a challenge into an opportunity for deeper mechanistic insights into BCQ_5165 function.

What bioinformatic approaches can provide insights into BCQ_5165 function based on sequence and structural analysis?

Comprehensive bioinformatic analysis can yield valuable insights into BCQ_5165 function through multiple computational approaches:

  • Sequence-Based Analysis:

    • Homology detection using PSI-BLAST and HHpred to identify distant relatives

    • Multiple sequence alignment of UPF0059 family members to identify conserved motifs

    • Evolutionary analysis to detect positively selected residues potentially involved in specificity

    • Conservation mapping to identify functionally important regions

  • Structural Prediction and Analysis:

    • Ab initio and template-based 3D modeling using tools like AlphaFold2, I-TASSER, or SWISS-MODEL

    • Electrostatic surface potential calculation to identify potential ion pathways

    • Molecular dynamics simulations to study conformational dynamics in membrane environments

    • Docking studies with potential substrates (Mn²⁺) and inhibitors

  • Functional Site Prediction:

    • Metal-binding site prediction using tools like MetalDetector and MIB

    • Transmembrane channel/pore prediction using specialized algorithms

    • Protein-protein interaction interface prediction

  • Integrative Approaches:

    • Gene neighborhood analysis to identify functionally related genes

    • Co-expression network analysis from transcriptomic datasets

    • Phylogenetic profiling to identify genes with correlated evolutionary patterns

  • Predictive Models for Experimental Design:

    Analysis ApproachPredictive OutcomeExperimental Validation
    Conserved motif identificationPotential metal-binding sitesSite-directed mutagenesis
    Structural modelingChannel/pore dimensionsConductance measurements
    Electrostatic mappingIon selectivity mechanismsIon competition assays
    Conformational change predictionPotential gating mechanismsFRET-based conformational sensors
    Genomic context analysisFunctional partnersCo-immunoprecipitation targets

These bioinformatic approaches generate testable hypotheses and guide efficient experimental design by focusing on the most promising aspects of BCQ_5165 structure and function.

How might research on BCQ_5165 contribute to understanding bacterial stress responses and survival mechanisms?

Research on BCQ_5165 extends beyond basic characterization to provide insights into fundamental bacterial biology:

  • Metal Homeostasis Mechanisms:

    • BCQ_5165's role as a putative manganese efflux pump illuminates mechanisms of metal detoxification

    • Comparison between vegetative cells and spores reveals adaptation of metal homeostasis machinery during lifecycle transitions

    • Potential for discovering novel manganese-responsive regulatory networks

  • Membrane Adaptation Strategies:

    • Differential expression of BCQ_5165 between growth states demonstrates membrane proteome remodeling

    • Insights into how bacteria maintain membrane functionality during dormancy

    • Understanding of protein sorting mechanisms during sporulation

  • Stress Response Integration:

    • Connections between manganese homeostasis and oxidative stress response

    • Potential role in virulence and host interaction through metal competition

    • Links between nutrient availability, metal homeostasis, and cellular differentiation

  • Evolutionary Perspectives:

    • Conservation patterns across diverse bacterial species suggest fundamental roles

    • Potential for identifying novel stress response mechanisms unique to endospore-forming bacteria

    • Understanding of membrane protein evolution in the context of different ecological niches

  • Research Application Areas:

    Research AreaContribution of BCQ_5165 StudiesPotential Impact
    Sporulation biologyMembrane transformations during sporulationUnderstanding bacterial persistence
    Metal biologyManganese transport mechanismsInsights into nutritional immunity
    Antimicrobial developmentNovel targets in membrane homeostasisPotential sporulation inhibitors
    Systems biologyIntegration of transporters in cellular networksPredictive models of bacterial adaptation
    Synthetic biologyEngineered metal homeostasisBiosensors and bioremediation applications

This research connects molecular mechanisms to cellular adaptation strategies, providing a systems-level understanding of bacterial survival mechanisms.

What experimental approaches can be used to investigate differences in BCQ_5165 function between vegetative cells and spores?

The differential context of BCQ_5165 in vegetative cells versus spores presents unique research opportunities:

  • State-Specific Purification and Characterization:

    • Isolation of membrane fractions from synchronized vegetative cells versus mature spores

    • Comparison of BCQ_5165 post-translational modifications between states

    • Structural analysis in different membrane environments

  • Functional Comparison Methodologies:

    • Transport assays using membrane vesicles derived from both cell states

    • Electrophysiological characterization in native membrane patches

    • Fluorescence-based ion flux measurements in intact cells/spores

  • Localization and Dynamics Studies:

    • Super-resolution microscopy to track BCQ_5165 distribution during sporulation

    • FRAP (Fluorescence Recovery After Photobleaching) to measure mobility differences

    • Single-molecule tracking to detect conformational states

  • Differential Interaction Mapping:

    • Comparative crosslinking-MS studies between vegetative and spore membranes

    • Identification of state-specific interaction partners

    • Construction of differentiation-stage specific protein interaction networks

  • Experimental Design Framework:

    Research QuestionVegetative Cell ApproachSpore ApproachComparative Analysis
    Protein abundanceQuantitative proteomicsSpecialized spore extractionDifferential expression analysis
    Functional stateReal-time transport assaysGermination-linked assaysActivity correlation with lifecycle
    Regulatory controlPromoter activity analysisStage-specific regulationIdentification of sporulation-specific control
    Protein turnoverPulse-chase analysisStability during dormancyHalf-life determination across states
    Structural differencesNative membrane studiesInner spore membrane isolationConformational comparison

These approaches would provide unprecedented insights into how membrane proteins like BCQ_5165 adapt functionally between active and dormant cellular states, potentially revealing novel regulatory mechanisms .

What are the key methodological considerations for researchers beginning work with BCQ_5165?

Researchers initiating studies on BCQ_5165 should consider these critical methodological recommendations:

  • Expression and Purification Strategy:

    • Use E. coli expression systems with careful optimization of induction conditions

    • Implement detergent screening to identify optimal solubilization conditions

    • Purify using His-tag affinity chromatography with attention to buffer composition

    • Validate protein quality using multiple biophysical techniques

  • Functional Characterization Approach:

    • Begin with well-established manganese transport assays

    • Implement proper controls for background transport activities

    • Develop quantitative assays that can detect kinetic parameters

    • Consider both in vitro reconstituted systems and in vivo approaches

  • Experimental Design Implementation:

    • Use DOE principles to systematically explore experimental parameters

    • Implement sufficient replication to ensure statistical power

    • Control for batch effects through appropriate blocking

    • Document all experimental conditions comprehensively

  • Complementary Technique Integration:

    • Combine structural, functional, and genetic approaches

    • Validate findings across multiple experimental systems

    • Address discrepancies through systematic investigation rather than selective reporting

  • Research Program Development:

    Research PhaseKey ConsiderationsCommon Pitfalls to Avoid
    Initial characterizationFocus on reproducible assaysOverinterpretation of preliminary data
    Mechanistic investigationTest multiple competing hypothesesConfirmation bias toward single mechanism
    Comparative studiesControl for preparation differencesDirect comparison without standardization
    Integration with broader biologyConnect to established pathwaysIsolation from biological context
    Application developmentConsider physiological relevancePremature transition to applications

Following these methodological recommendations will establish a solid foundation for productive research on BCQ_5165 and related membrane proteins.

What are the most promising future research directions for understanding BCQ_5165 function in bacterial physiology?

The study of BCQ_5165 opens several promising research frontiers:

  • Structural Biology Frontiers:

    • High-resolution structure determination of BCQ_5165 in multiple conformational states

    • Mapping of the manganese permeation pathway

    • Visualization of potential gating mechanisms

    • Integration of structural data with functional measurements

  • Systems Biology Integration:

    • Comprehensive mapping of the manganese homeostasis network

    • Integration of BCQ_5165 function with global stress response systems

    • Modeling of metal ion fluxes during state transitions

    • Understanding compensatory mechanisms in BCQ_5165 mutants

  • Comparative Biology Perspectives:

    • Functional comparison across diverse bacterial species

    • Investigation of BCQ_5165 homologs in non-sporulating bacteria

    • Evolutionary analysis of metal efflux systems

  • Technological Innovation Opportunities:

    • Development of BCQ_5165-based manganese biosensors

    • Exploration of BCQ_5165 as a potential antimicrobial target

    • Engineering of BCQ_5165 for biotechnological applications

  • Priority Research Directions:

    Research AreaSpecific DirectionPotential Impact
    Transport mechanismDetermination of energy coupling mechanismFundamental understanding of metal efflux
    Regulatory networksIdentification of BCQ_5165 regulatorsIntegration with stress response systems
    Sporulation-specific roleFunction during spore formation and germinationUnderstanding of dormancy mechanisms
    Host-pathogen interactionsRole in virulence and host defense evasionNovel antimicrobial approaches
    Synthetic biology applicationsEngineering metal homeostasisBiosensors and bioremediation tools

These research directions promise to transform our understanding of bacterial metal homeostasis while potentially yielding applications in biotechnology and medicine. The unique position of BCQ_5165 at the intersection of membrane biology, metal homeostasis, and bacterial differentiation makes it a particularly valuable subject for continued investigation.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.