Recombinant Bacillus cereus UPF0295 protein BC_0520 (BC_0520)

Shipped with Ice Packs
In Stock

Description

General Information

The Bacillus cereus UPF0295 protein BC_0520, also referred to as UPF0295 protein BC_0520, is a protein derived from the bacterium Bacillus cereus . Bacillus cereus is a Gram-positive, rod-shaped, motile, spore-forming bacterium commonly found in various environments such as soil, vegetation, and food . It is a facultatively anaerobic bacterium that can produce toxins and is known to cause foodborne illnesses .

Protein Characteristics

UniProtKB provides comprehensive information regarding the protein sequence and function of the Bacillus cereus UPF0295 protein BC_0520 . Recombinant proteins are produced using recombinant DNA technology, which involves introducing the gene encoding the protein into a host cell, such as mammalian cells, to produce the protein in large quantities . Repeated freezing and thawing of the recombinant protein is not recommended, and working aliquots should be stored at 4°C for up to one week .

Role of EntD in Bacillus cereus

Bacillus cereus EntD is identified as a crucial exoprotein through proteogenomics. The protein encoded by BC_3716 shares similarities with exoproteins EntA, EntB, and EntC . Deletion of entD affects Bacillus cereus, impacting its growth rate and glucose catabolism . The entD mutant grew slower than the wild-type strain, indicating that entD disruption influences glucose catabolism independently of oxygen .

Impact on Cell Wall and Stress Response

The majority of differentially expressed cell wall-associated proteins are downregulated in the ΔentD strain . The ΔentD mutation significantly increased the abundance level of components of the general stress response system, thiol-specific stress-related proteins, and other stress-related proteins . Bacillus cereus cells deficient in EntD are more susceptible to the deleterious effects of hydrogen peroxide than wild-type cells .

Influence on Exoproteome and Virulence Factors

EntD deficiency affects the distribution pattern of cell wall-associated enzymes and the abundance levels of degradative enzymes in a growth phase-dependent manner . Cytotoxic effects of filtrate supernatants from ΔentD and wild-type cells on Caco-2 cells, with Caco-2 cells being more sensitive to wild-type filtrate supernatants than to ΔentD filtrate supernatant . EntD regulates the cytotoxic potential of Bacillus cereus cells by modulating its exoproteome .

Product Specs

Form
Lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a guideline.
Shelf Life
Shelf life depends on several factors: storage conditions, buffer components, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.
If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
BC_0520; UPF0295 protein BC_0520
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-118
Protein Length
full length protein
Species
Bacillus cereus (strain ATCC 14579 / DSM 31 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NRRL B-3711)
Target Names
BC_0520
Target Protein Sequence
MSIKYSNKINKIRTFALSLVFIGLFIAYLGVFFRENIIIMTTFMMVGFLAVIASTVVYFW IGMLSTKTIQIICPSCDKPTKMLGRVDACMHCNQPLTLDRDLEGKEFDEKYNKKSYKS
Uniprot No.

Target Background

Database Links

KEGG: bce:BC0520

STRING: 226900.BC0520

Protein Families
UPF0295 family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is UPF0295 protein BC_0520 and why is it significant for research?

UPF0295 protein BC_0520 is a bacterial protein derived from Bacillus cereus, a gram-positive, facultatively anaerobic bacterium widely recognized as a foodborne pathogen. The designation "UPF0295" indicates its classification within an uncharacterized protein family (UPF), meaning that while the protein has been identified and sequenced, its precise biological function remains incompletely understood in scientific literature. The "BC_0520" refers to the specific gene locus within the B. cereus genome.

The protein's significance for research stems from several factors:

  • Its uncharacterized nature presents opportunities for novel function discovery

  • Its association with B. cereus, a known human pathogen that causes food poisoning and other infections

  • Potential implications for understanding bacterial physiology and pathogenesis mechanisms

  • Possible applications in diagnostic development for detecting B. cereus in food samples

This protein serves as an important model for studying proteins of unknown function and their potential roles in bacterial pathogenicity and survival.

How does Bacillus cereus (the source organism) relate to other Bacillus species in terms of phylogeny?

Bacillus cereus is part of the Bacillus cereus group, which includes several closely related Bacillus species. The most well-studied members include B. anthracis (the causative agent of anthrax), B. cereus, and B. thuringiensis (used as a biopesticide). These species share extremely close evolutionary relationships as evidenced by:

  • High genome sequence similarity and gene synteny

  • Similar cell morphology and physiology

  • Shared aspects of spore formation and structure

Current phylogenetic analysis divides the B. cereus group into 5 major clades which do not directly correspond to the traditional species designations. This has led some researchers to propose that the B. cereus group should be considered a single species with different subspecies (e.g., B. cereus subsp. cereus, B. cereus subsp. anthracis, B. cereus subsp. thuringiensis) .

The primary distinguishing features between these species are often associated with plasmid-encoded virulence factors rather than chromosomal differences. For example, B. anthracis contains the pXO plasmids encoding toxins and capsule genes, while B. thuringiensis harbors cry plasmids encoding insecticidal proteins .

This close phylogenetic relationship has significant implications for researchers working with B. cereus proteins, as findings may have relevance to related species within the group.

What are the physicochemical properties of recombinant UPF0295 protein BC_0520?

While comprehensive biophysical characterization is not extensively documented in literature, recombinant UPF0295 protein BC_0520 exhibits several key physicochemical properties:

  • Structural features: The protein sequence suggests the presence of transmembrane regions based on the concentration of hydrophobic amino acids in specific segments, particularly in the N-terminal half of the sequence

  • Solubility: As a recombinant protein, solubility varies depending on expression system and buffer conditions, with optimal stability achieved in specific buffer compositions (see table below)

  • Stability: The protein stability is maximized in specific buffer conditions as outlined in the following table:

Buffer ComponentTypical ConcentrationPurpose
Tris-based bufferVariablepH maintenance
Glycerol20-50%Cryoprotection
pH range7.5-8.0Optimal stability

For lyophilized protein preparations, proper handling protocols include:

  • Brief centrifugation prior to opening to collect material

  • Reconstitution in deionized sterile water to 0.1-1.0 mg/mL

  • Addition of glycerol to 5-50% final concentration for freezer storage

  • Gentle mixing rather than vigorous agitation to avoid denaturation

What expression systems are optimal for producing recombinant UPF0295 protein BC_0520?

The choice of expression system for recombinant UPF0295 protein BC_0520 production depends on research requirements, particularly regarding yield, post-translational modifications, and experimental timeline. The following table compares the main expression systems and their respective advantages:

Expression HostAdvantagesYieldTurnaround TimePost-translational Modifications
E. coliCost-effective, high yieldHighShortMinimal
YeastHigher eukaryotic systemGoodMediumModerate
Baculovirus/Insect cellsMore complex modificationsModerateLongerExtensive
Mammalian cellsMost native-like processingVariableLongestMost comprehensive

The specific expression strain selection should account for codon optimization, potential toxicity of the recombinant protein to the host, and requirements for disulfide bond formation or other specific post-translational modifications.

What purification strategies are most effective for UPF0295 protein BC_0520?

Effective purification of recombinant UPF0295 protein BC_0520 typically employs affinity chromatography as the primary capture step, followed by additional polishing steps to achieve high purity. The following methodological approach is recommended:

  • Affinity tag selection: Recombinant UPF0295 protein BC_0520 is commonly produced with affinity tags to facilitate purification, with the following considerations:

Tag TypeCommon PositionApplicationsImpact on Structure/Function
His-tagN-terminalPurification via metal affinityMinimal impact on structure
Other tagsVariableDetection, solubility enhancementDetermined during production
  • Purification protocol:

    • Cell lysis: Sonication or chemical lysis in appropriate buffer conditions

    • Clarification: Centrifugation to remove cell debris

    • Affinity chromatography: Using Ni-NTA or similar resin for His-tagged protein

    • Additional purification: Size exclusion chromatography or ion exchange chromatography as needed

    • Quality control: SDS-PAGE and/or Western blotting to verify purity

  • Expected purity levels:

    • Commercial sources typically achieve ≥85-90% purity as verified by SDS-PAGE

    • Research-grade preparations may vary depending on purification methods employed

For applications requiring extremely high purity (e.g., structural studies), additional chromatography steps may be necessary to remove trace contaminants or aggregates.

How can the biological activity of purified UPF0295 protein BC_0520 be assessed?

Assessing the biological activity of UPF0295 protein BC_0520 presents unique challenges due to its uncharacterized nature. The following methodological approaches can be employed:

  • Structural integrity assessment:

    • Circular dichroism (CD) spectroscopy to confirm secondary structure elements

    • Size exclusion chromatography to evaluate oligomerization state

    • Thermal shift assays to assess protein stability

  • Functional characterization strategies:

    • Protein-protein interaction studies using pull-down assays, co-immunoprecipitation, or yeast two-hybrid systems to identify binding partners

    • Enzymatic activity screening using substrate panels to detect potential catalytic functions

    • Comparative analysis with structurally similar proteins of known function

    • Binding assays with potential ligands or substrates

  • Context-based approaches:

    • Gene knockout/complementation studies in B. cereus to observe phenotypic changes

    • Expression profiling under different growth conditions to identify regulatory patterns

    • Subcellular localization studies to determine cellular distribution

Due to the UPF0295 family's uncharacterized nature, a combination of these approaches may be necessary to elucidate the protein's function. Researchers should design experiments that account for the protein's predicted structural features, such as potential transmembrane regions, which may influence experimental design and interpretation.

What structural information is available for UPF0295 protein BC_0520, and how can researchers expand on this?

  • Computational structure prediction:

    • Homology modeling based on structurally characterized members of the UPF0295 family

    • Ab initio modeling using current machine learning approaches (e.g., AlphaFold2)

    • Molecular dynamics simulations to predict dynamic properties

  • Experimental structure determination:

    • X-ray crystallography: Requires obtaining protein crystals through screening of various crystallization conditions

    • Nuclear Magnetic Resonance (NMR) spectroscopy: Suitable for smaller proteins or domains

    • Cryo-electron microscopy (cryo-EM): Particularly useful if the protein forms larger complexes

  • Structural feature analysis:

    • Limited proteolysis combined with mass spectrometry to identify domain boundaries

    • Hydrogen-deuterium exchange mass spectrometry to probe solvent accessibility

    • Cross-linking mass spectrometry to identify spatial proximities within the protein

The transmembrane regions predicted in the N-terminal half of the sequence pose particular challenges for structural studies and may require specialized approaches such as detergent screening or the use of nanodiscs to maintain proper folding during purification and analysis.

Researchers seeking to determine the structure should consider expressing constructs of varying lengths to identify stable domains amenable to structural studies, as full-length membrane-associated proteins often present difficulties in structural determination.

How does UPF0295 protein BC_0520 potentially contribute to B. cereus pathogenicity?

While the specific role of UPF0295 protein BC_0520 in B. cereus pathogenicity has not been definitively established, several experimental approaches can help researchers investigate this question:

  • Contextual analysis within pathogenicity mechanisms:
    B. cereus causes two distinct forms of food poisoning:

    • Diarrheal syndrome: Caused by enterotoxins including haemolysin BL (Hbl), non-hemolytic enterotoxin (Nhe), and cytotoxin K (CytK)

    • Emetic syndrome: Caused by cereulide toxin produced before ingestion

    Researchers should investigate potential interactions between UPF0295 protein BC_0520 and these established virulence factors.

  • Comparative expression analysis:

    • Quantitative PCR or RNA-seq to compare expression levels between virulent and avirulent strains

    • Expression analysis under conditions mimicking host environments versus standard growth conditions

    • Proteomic analysis to identify co-expressed proteins during infection models

  • Functional characterization in pathogenicity models:

    • Generation of BC_0520 knockout mutants to assess changes in virulence in appropriate model systems

    • Complementation studies to confirm phenotypic changes are specifically linked to BC_0520

    • Host cell interaction studies to investigate effects on adhesion, invasion, or cytotoxicity

  • Potential roles based on B. cereus pathogenicity mechanisms:

    • Involvement in stress response during host colonization

    • Potential role in antimicrobial resistance, given B. cereus exhibits specific patterns of resistance:

    Antimicrobial AgentTypical Susceptibility
    PenicillinResistant (100%)
    AmoxicillinResistant (100%)
    GentamicinSusceptible (97.6%)
    ImipenemSusceptible (99.7%)
    CiprofloxacinSusceptible (92.9%)
    ChloramphenicolSusceptible (94.6%)
    TeicoplaninSusceptible (81%)

Understanding B. cereus' role in food contamination (particularly in heat-treated pastries, non-heat-treated cream, delicatessen products, and rice/starchy foods) provides context for investigating BC_0520's potential contribution to survival in these food matrices .

How can UPF0295 protein BC_0520 be utilized in antibody development and immunological research?

UPF0295 protein BC_0520 can be strategically employed in antibody development and immunological research through several methodological approaches:

  • Antibody production protocol:

    • Immunization: Use purified recombinant UPF0295 protein BC_0520 (typically >85% purity) as an immunogen

    • Host selection: Rabbits for polyclonal antibodies; mice or rats for monoclonal antibody development

    • Adjuvant selection: Complete Freund's adjuvant for primary immunization followed by incomplete Freund's for boosters

    • Verification: ELISA screening against the immunizing antigen followed by Western blot validation

  • Applications of anti-UPF0295 protein BC_0520 antibodies:

    • Detection of B. cereus in environmental or food samples via immunoassays

    • Immunolocalization studies to determine cellular distribution of the protein

    • Immunoprecipitation to identify interaction partners

    • Western blotting to study expression levels under different conditions

  • Host-pathogen interaction studies:

    • Investigation of potential interaction with host immune components

    • Analysis of protein expression during different stages of infection

    • Evaluation of potential as a biomarker for B. cereus infection

    • Assessment of immunogenicity and potential as a vaccine candidate

The particular value of antibodies against UPF0295 protein BC_0520 lies in their potential to elucidate the protein's biological function through localization, quantification, and interaction studies, especially important for members of uncharacterized protein families where function remains unknown.

What approaches can be used to investigate potential enzymatic activities of UPF0295 protein BC_0520?

Investigating potential enzymatic activities of UPF0295 protein BC_0520 requires systematic approaches given its uncharacterized nature:

  • Bioinformatic prediction of potential enzymatic function:

    • Sequence comparison with characterized enzymes using tools like BLAST, HHpred, or Pfam

    • Structure-based function prediction if structural data becomes available

    • Analysis of conserved motifs and catalytic residues across the UPF0295 family

    • Genomic context analysis examining neighboring genes that may provide functional clues

  • High-throughput enzymatic screening:

    • Activity-based protein profiling using chemical probes

    • Substrate panels covering major enzyme classes (hydrolases, transferases, oxidoreductases, etc.)

    • Metabolite profiling in knockout mutants compared to wild-type

    • Differential scanning fluorimetry (thermal shift assays) with potential substrates or cofactors

  • Targeted enzymatic assays based on predicted functions:

    • Design specific assays based on bioinformatic predictions

    • Measure activity using appropriate spectrophotometric, fluorometric, or chromatographic methods

    • Site-directed mutagenesis of predicted catalytic residues to confirm mechanism

    • Kinetic characterization with identified substrates

  • Structural analysis to support enzymatic characterization:

    • Co-crystallization with substrates, products, or inhibitors

    • Binding studies using isothermal titration calorimetry or surface plasmon resonance

    • NMR to detect structural changes upon ligand binding

These approaches should be applied iteratively, with results from initial screens informing the design of more targeted follow-up experiments to comprehensively characterize any enzymatic functions of UPF0295 protein BC_0520.

What are the critical factors for maintaining stability of UPF0295 protein BC_0520 during experiments?

Maintaining stability of UPF0295 protein BC_0520 during experiments requires careful attention to several critical factors:

  • Buffer optimization:

    • Maintain pH between 7.5-8.0, which has been identified as optimal for stability

    • Include glycerol (20-50%) as a cryoprotectant for long-term storage

    • Consider addition of reducing agents (e.g., DTT or β-mercaptoethanol) if disulfide formation is problematic

    • Test various salt concentrations to identify optimal ionic strength

  • Temperature considerations:

    • Store lyophilized protein at -20°C or -80°C

    • Avoid repeated freeze-thaw cycles by preparing single-use aliquots

    • Perform experiments at consistent temperatures, typically 4°C or room temperature depending on the application

    • Monitor thermal stability using techniques such as differential scanning fluorimetry

  • Handling procedures:

    • For lyophilized preparations, briefly centrifuge before opening to collect material

    • Reconstitute in deionized sterile water to 0.1-1.0 mg/mL

    • Use gentle mixing rather than vigorous agitation to prevent denaturation

    • Filter sterilize if necessary, using low protein-binding filters

  • Additives to enhance stability:

    • Consider addition of specific metal ions if the protein requires cofactors

    • Test protein-stabilizing compounds such as arginine or trehalose

    • For membrane-associated regions, addition of mild detergents may improve stability

    • Protease inhibitors may be necessary in certain experimental contexts

  • Storage recommendations:

    • Short-term (1-2 weeks): 4°C in appropriate buffer

    • Medium-term (1-3 months): -20°C with glycerol as cryoprotectant

    • Long-term (>3 months): -80°C or maintain as lyophilized powder

Systematic characterization of stability under various conditions is recommended before proceeding with complex experimental protocols to ensure consistent and reliable results.

How should researchers address the challenges of working with a protein from an uncharacterized family?

Working with UPF0295 protein BC_0520 from an uncharacterized protein family presents unique challenges that require systematic approaches:

The uncharacterized nature of UPF0295 protein BC_0520 makes it both challenging and potentially rewarding as a research subject, with opportunities for novel discoveries about bacterial physiology and pathogenesis mechanisms.

How can systems biology approaches enhance our understanding of UPF0295 protein BC_0520 function?

Systems biology approaches offer powerful strategies to contextualize UPF0295 protein BC_0520 within broader cellular networks and elucidate its function:

  • Multi-omics integration:

    • Integrate transcriptomics, proteomics, and metabolomics data to identify correlated changes

    • Compare wild-type and BC_0520 knockout strains under various conditions

    • Apply network analysis to position BC_0520 within cellular pathways

    • Use temporal profiling to identify dynamic relationships with other cellular components

  • Interactome mapping methodologies:

    • Perform comprehensive protein-protein interaction screens (yeast two-hybrid or proximity labeling)

    • Validate interactions using co-immunoprecipitation or bimolecular fluorescence complementation

    • Map genetic interactions through synthetic lethality screens

    • Investigate potential RNA or DNA interactions if bioinformatic analysis suggests nucleic acid binding

  • Computational modeling:

    • Develop predictive models of protein function based on interactome data

    • Create genome-scale metabolic models including BC_0520

    • Use machine learning to identify patterns in multi-omics datasets

    • Simulate effects of BC_0520 perturbation on cellular networks

  • Evolutionary systems biology:

    • Compare UPF0295 family proteins across different bacterial species

    • Analyze co-evolution patterns with other genes to infer functional relationships

    • Examine gene neighborhood conservation across bacterial genomes

    • Investigate potential horizontal gene transfer events involving the UPF0295 family

These systems-level approaches can provide context for UPF0295 protein BC_0520 function beyond what can be achieved through traditional reductionist methods, potentially revealing unexpected connections and functions relevant to B. cereus physiology and pathogenicity .

What emerging technologies could advance research on UPF0295 protein BC_0520?

Several cutting-edge technologies offer promising avenues for advancing research on UPF0295 protein BC_0520:

  • Advanced structural determination methods:

    • AlphaFold and other AI-based structure prediction tools to generate high-confidence structural models

    • Micro-electron diffraction (MicroED) for structural determination from nanocrystals

    • Integrative structural biology combining multiple experimental data sources

    • Time-resolved structural methods to capture conformational dynamics

  • Genome editing and high-throughput screening:

    • CRISPR-Cas9 systems optimized for B. cereus to create precise genetic modifications

    • CRISPRi/CRISPRa for reversible modulation of gene expression

    • High-content screening to identify phenotypic changes in response to genetic modifications

    • Barcoded mutant libraries for pooled functional genomics

  • Single-cell technologies:

    • Single-cell RNA-seq to examine heterogeneity in bacterial populations

    • Spatial transcriptomics to map gene expression during host-pathogen interactions

    • Single-cell proteomics to detect protein-level changes

    • Microfluidics-based single-cell phenotyping

  • Advanced imaging techniques:

    • Super-resolution microscopy to visualize subcellular localization

    • Label-free imaging methods for tracking proteins in live cells

    • Correlative light and electron microscopy for integrated structural and functional analysis

    • Intravital imaging to track bacterial proteins during infection in animal models

  • Artificial intelligence applications:

    • Machine learning for prediction of protein-protein interactions

    • Deep learning for analysis of high-dimensional experimental data

    • Natural language processing to extract relevant information from literature

    • AI-driven experimental design optimization

These emerging technologies can address critical gaps in our understanding of UPF0295 protein BC_0520, particularly regarding its structural properties, interaction network, and functional role in bacterial physiology and pathogenicity .

How might research on UPF0295 protein BC_0520 contribute to broader understanding of bacterial pathogenesis?

Research on UPF0295 protein BC_0520 has potential to contribute significantly to our broader understanding of bacterial pathogenesis through several conceptual frameworks:

  • Uncharacterized protein families in virulence:

    • Establishing methodologies for characterizing proteins of unknown function in pathogens

    • Potentially revealing novel virulence mechanisms not previously described

    • Identifying new classes of proteins involved in host-pathogen interactions

    • Understanding the role of accessory genome components in pathogen evolution

  • Comparative pathogenesis within the B. cereus group:

    • Elucidating shared mechanisms across B. cereus, B. anthracis, and B. thuringiensis

    • Understanding how chromosomal genes interact with plasmid-encoded virulence factors

    • Identifying conserved pathways that could serve as broad-spectrum therapeutic targets

    • Clarifying evolutionary relationships between closely related pathogens

  • Host-pathogen interaction dynamics:

    • Investigating potential interactions with host immune components

    • Understanding bacterial adaptation to different host environments

    • Elucidating mechanisms of persistence and transmission

    • Identifying factors involved in crossing host barriers (e.g., brain barrier)

  • Therapeutic and diagnostic applications:

    • Development of novel diagnostic approaches for B. cereus infections

    • Identification of new drug targets for antimicrobial development

    • Understanding mechanisms of antimicrobial resistance

    • Potential vaccine candidate evaluation

  • Environmental adaptation and transmission:

    • Understanding mechanisms of survival in food matrices

    • Elucidating role in biofilm formation and environmental persistence

    • Investigating potential involvement in spore formation or germination

    • Clarifying adaptation to different environmental stressors

By investigating this uncharacterized protein within the context of a significant human pathogen, researchers can potentially uncover novel aspects of bacterial pathogenesis with broader implications for understanding and combating bacterial infections .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.