Recombinant Bacillus cereus UPF0295 protein BCA_0557 (BCA_0557)

Shipped with Ice Packs
In Stock

Description

Introduction to Recombinant Bacillus cereus UPF0295 Protein BCA_0557

Recombinant Bacillus cereus UPF0295 protein BCA_0557 is a recombinant protein derived from the bacterium Bacillus cereus. This protein is part of the UPF0295 family, which is known for its conserved domains across various bacterial species. The specific protein BCA_0557 is identified by its ordered locus name and is associated with the strain Bacillus cereus 03BB102.

Key Features of Recombinant Bacillus cereus UPF0295 Protein BCA_0557

  • Species: Bacillus cereus (strain 03BB102)

  • Uniprot ID: C1EWH3

  • Tag Type: Determined during production

  • Storage Buffer: Tris-based buffer with 50% glycerol

  • Storage Conditions: Store at -20°C or -80°C for extended storage; avoid repeated freezing and thawing .

Protein Structure and Sequence

The recombinant protein BCA_0557 has a specific amino acid sequence that defines its structure and function. The sequence is as follows:

MSIKYSNKINKIRTFALSLVFIGLFIAYLGVFFRENIIIMTTFMMVGFLAVIASTVVYFW IGMLSTKTVQIICPSCDKPTKMLGRVDACMHCNQPLTMDRDLEGKEFDEKYNKKSYKS\text{MSIKYSNKINKIRTFALSLVFIGLFIAYLGVFFRENIIIMTTFMMVGFLAVIASTVVYFW IGMLSTKTVQIICPSCDKPTKMLGRVDACMHCNQPLTMDRDLEGKEFDEKYNKKSYKS}

This sequence is crucial for understanding the protein's interactions and potential applications.

Sequence Information

ParameterDescription
Protein Length1-118 amino acids
Sequence TypeFull-length protein
Tag InformationHis-tag or other tags depending on production

Expression and Production

The recombinant UPF0295 protein BCA_0557 is typically expressed in Escherichia coli (E. coli), a common host for recombinant protein production due to its well-understood genetics and ease of manipulation. The protein is often purified and provided in a lyophilized form for convenience and stability .

Production Details

  • Expression Host: Escherichia coli

  • Purification Method: Typically involves chromatography techniques

  • Form: Lyophilized powder for ease of storage and transport

Potential Applications

  1. Biotechnology: Recombinant proteins can be used in biotechnological applications such as enzyme production or as tools in molecular biology.

  2. Medical Research: Understanding the functions of proteins like BCA_0557 can provide insights into bacterial pathogenicity mechanisms.

  3. Environmental Studies: Bacillus cereus proteins might be involved in environmental processes, such as soil remediation or plant protection.

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Our standard shipping includes blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, but this can be adjusted as needed.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer components, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
If you require a specific tag type, please inform us for preferential development.
Synonyms
BCA_0557; UPF0295 protein BCA_0557
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-118
Protein Length
full length protein
Species
Bacillus cereus (strain 03BB102)
Target Names
BCA_0557
Target Protein Sequence
MSIKYSNKINKIRTFALSLVFIGLFIAYLGVFFRENIIIMTTFMMVGFLAVIASTVVYFW IGMLSTKTVQIICPSCDKPTKMLGRVDACMHCNQPLTMDRDLEGKEFDEKYNKKSYKS
Uniprot No.

Target Background

Database Links

KEGG: bcx:BCA_0557

Protein Families
UPF0295 family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is the UPF0295 protein family and what is known about BCA_0557's function?

UPF0295 represents an uncharacterized protein family with members distributed across various bacterial species, including Bacillus cereus. While the specific function of BCA_0557 remains incompletely understood, structural analysis suggests it may function as a membrane protein involved in stress response pathways or virulence mechanisms. The protein contains transmembrane domains characteristic of membrane-associated proteins, with sequence analysis suggesting potential roles in ion transport or signaling processes .
Homology studies with related proteins indicate UPF0295 family proteins may contribute to bacterial adaptation to environmental stressors, potentially including antimicrobial compounds or host immune responses. Current research aims to elucidate the precise biological function through knockout studies and interactome analysis.

What are the physical and biochemical properties of recombinant BCA_0557?

The recombinant BCA_0557 protein is typically produced as a full-length protein (118 amino acids) with an N-terminal His-tag to facilitate purification. Key properties include:

PropertySpecificationNotes
Molecular Weight~13 kDaExcluding tag
Isoelectric Point (pI)~8.2Calculated theoretical value
Protein StructurePrimarily α-helicalBased on predictive modeling
SolubilityLimited in aqueous solutionsMay require detergents for solubilization
StabilityModerate thermal stabilityMaintains structure at room temperature
The hydrophobic regions within the amino acid sequence suggest membrane association, which can present challenges for maintaining native conformation during purification and experimental procedures .

What expression systems are most effective for producing recombinant BCA_0557?

E. coli represents the predominant expression system for recombinant BCA_0557 production, balancing yield with experimental simplicity. For optimal expression:

  • Select an appropriate E. coli strain (BL21(DE3), Rosetta, or C41/C43 for membrane proteins)

  • Optimize codon usage for bacterial expression

  • Consider fusion tags beyond His-tag (e.g., MBP, SUMO) if solubility issues arise

  • Implement temperature modulation during induction (typically 16-25°C)

  • Test multiple induction concentrations (0.1-1.0 mM IPTG)
    Expression in insect cell systems may provide superior folding for functional studies but introduces additional complexity and cost. Bacterial expression typically yields 2-5 mg of purified protein per liter of culture under optimized conditions .

What purification strategy delivers the highest purity and yield?

A multi-step purification approach is recommended to achieve >90% purity:

  • Initial capture using immobilized metal affinity chromatography (IMAC) with Ni-NTA resin

  • Buffer exchange to remove imidazole (using dialysis or gel filtration)

  • Secondary purification using ion-exchange chromatography

  • Final polishing step with size-exclusion chromatography
    For membrane-associated proteins like BCA_0557, incorporation of mild detergents (0.03-0.1% DDM or 0.5-1% CHAPS) throughout purification helps maintain protein solubility and native conformation. SDS-PAGE analysis following each purification step should demonstrate progressive improvement in purity, with final purity exceeding 90% as verified by densitometry .

What are the optimal storage conditions to maintain BCA_0557 stability?

The recombinant protein is typically supplied as a lyophilized powder, which should be properly reconstituted before use. For long-term stability:

  • Store lyophilized protein at -20°C or preferably -80°C

  • After reconstitution, prepare small working aliquots to avoid repeated freeze-thaw cycles

  • Add cryoprotectants such as glycerol (final concentration 20-50%) to prevent freeze-damage

  • Store working aliquots at 4°C for up to one week or at -80°C for extended periods
    The addition of 6% trehalose to Tris/PBS-based storage buffers (pH 8.0) significantly enhances protein stability during freezing and thawing cycles. Avoid more than 2-3 freeze-thaw cycles as this dramatically reduces protein activity .

How should recombinant BCA_0557 be reconstituted for experimental use?

For optimal reconstitution:

  • Briefly centrifuge the vial containing lyophilized protein to collect material at the bottom

  • Reconstitute to 0.1-1.0 mg/mL using deionized sterile water or appropriate buffer

  • Allow complete dissolution by gentle rotation or mixing (avoid vigorous vortexing)

  • For membrane proteins like BCA_0557, consider adding mild detergents if precipitation occurs

  • For long-term storage, add glycerol to 50% final concentration before aliquoting
    The reconstitution buffer should maintain pH 7.5-8.0 and contain stabilizing agents such as 150 mM NaCl. Complete dissolution may require 15-30 minutes at room temperature with occasional gentle mixing .

How can researchers design experiments to investigate BCA_0557's potential role in B. cereus virulence?

When investigating BCA_0557's role in virulence, consider these methodological approaches:

  • Gene knockout/knockdown studies in B. cereus followed by virulence assays

  • Protein-protein interaction studies to identify binding partners within pathogenicity pathways

  • Subcellular localization experiments using fluorescently tagged BCA_0557

  • Comparative proteomics between wild-type and BCA_0557-deficient strains under infection-relevant conditions

  • Structural biology approaches to identify potential binding sites for small molecules
    For experimental controls, include:

  • Parallel experiments with known B. cereus virulence factors

  • Complementation studies to confirm phenotypes are specifically due to BCA_0557 loss

  • Testing under various environmental conditions mimicking host environments
    The toxin expression profile of B. cereus significantly influences its pathogenicity. Research indicates 83% of B. cereus isolates harbor the nheABC gene cluster, while only 7% possess the emetic toxin-encoding cesB gene . Understanding how BCA_0557 interfaces with these established virulence mechanisms provides context for experimental design.

What are appropriate controls when working with recombinant BCA_0557?

Robust experimental design requires appropriate controls:

What methods are most suitable for determining the structure of BCA_0557?

Several complementary approaches can elucidate BCA_0557's structure:

  • X-ray Crystallography:

    • Requires high-purity protein (>95%)

    • Screen multiple crystallization conditions

    • Consider removing flexible regions or the His-tag to improve crystal formation

    • May require membrane-mimetic environments for proper folding

  • Nuclear Magnetic Resonance (NMR):

    • Suitable for smaller proteins (<20 kDa)

    • Requires isotope labeling (15N, 13C)

    • Can provide dynamic information about flexible regions

    • Less dependent on crystallization but requires high protein concentrations

  • Cryo-Electron Microscopy:

    • Particularly valuable for membrane proteins

    • No crystallization required

    • May require larger complexes for optimal resolution

    • Recent advances enable near-atomic resolution

  • Computational Approaches:

    • Homology modeling based on related structures

    • Molecular dynamics simulations to predict conformational changes

    • AI-based structure prediction (AlphaFold2) showing increasing accuracy
      The choice of method depends on research goals, available resources, and protein behavior during purification. A combination of approaches often provides the most comprehensive structural insights.

How does the His-tag affect structural studies and when should it be removed?

The N-terminal His-tag, while facilitating purification, can impact structural and functional studies of BCA_0557:

  • Structural Impacts:

    • May introduce conformational flexibility in crystal structures

    • Can interfere with native protein-protein interactions

    • Potentially alters surface charge distribution

  • Functional Considerations:

    • May affect protein activity, especially if near functional domains

    • Could introduce artificial binding properties

    • Might influence membrane insertion for membrane-associated proteins

  • Tag Removal Recommendations:

    • Remove for high-resolution structural studies

    • Consider maintaining for initial functional screening

    • Cleavage should be performed after initial purification steps

  • Cleavage Methods:

    • Tobacco Etch Virus (TEV) protease (high specificity)

    • Thrombin or Factor Xa (if appropriate recognition sites are present)

    • Verify complete cleavage via SDS-PAGE and Western blotting
      Include parallel experiments with tagged and untagged protein to assess tag effects on the specific experimental endpoints being measured.

How can BCA_0557 research contribute to understanding B. cereus pathogenicity mechanisms?

Research on BCA_0557 offers several avenues for understanding B. cereus pathogenicity:

  • Membrane Proteome Analysis:
    As a predicted membrane protein, BCA_0557 may participate in host-pathogen interactions, potentially contributing to adhesion, invasion, or immune evasion. Studies show 35% of ready-to-eat food samples tested positive for B. cereus, with significant virulence gene distribution - 39% harboring the hblACD gene cluster and 83% containing the nheABC genes . Investigating BCA_0557's relationship to these established virulence factors may reveal new pathogenicity mechanisms.

  • Stress Response Networks:
    B. cereus demonstrates remarkable environmental adaptability, contributing to its persistence in food production environments. BCA_0557 might play a role in stress adaptation pathways, particularly given the prevalence of B. cereus in diverse food matrices ranging from cooked meats (34% contamination) to rice/noodle samples (50% contamination) .

  • Antimicrobial Resistance:
    B. cereus isolates show significant resistance to β-lactam antibiotics and rifamycin . Investigating whether BCA_0557 contributes to this resistance profile, perhaps through membrane permeability regulation or efflux pump interaction, represents an important research direction.

  • Biofilm Formation:
    Membrane proteins often contribute to bacterial biofilm development. Examining BCA_0557's role in biofilm formation could explain B. cereus persistence in food processing environments and medical settings.

What new methodologies are emerging for studying proteins like BCA_0557?

Several cutting-edge approaches show promise for UPF0295 protein research:

  • Proximity Labeling Techniques:

    • BioID or APEX2 tagging to identify proximal interaction partners in live cells

    • Helps establish the protein's contextual environment and functional associates

    • Particularly valuable for membrane proteins with transient interactions

  • Native Mass Spectrometry:

    • Allows analysis of intact protein complexes

    • Maintains non-covalent interactions

    • Reveals stoichiometry and binding dynamics

  • Single-Molecule Studies:

    • FRET-based approaches to observe conformational changes

    • Optical tweezers or AFM for mechanical property assessment

    • Single-molecule tracking in live cells to observe dynamics

  • Integrative Structural Biology:

    • Combining multiple structural techniques (crystallography, cryo-EM, NMR)

    • Cross-linking mass spectrometry to identify interaction interfaces

    • Integrating experimental data with computational models

  • CRISPR-Based Approaches:

    • CRISPRi for controlled downregulation

    • Base editing for precise sequence modifications

    • CRISPR screens to identify genetic interactions
      These emerging methods can provide unprecedented insights into UPF0295 protein function within the broader context of B. cereus biology and pathogenicity.

What strategies can address poor solubility of recombinant BCA_0557?

Membrane-associated proteins like BCA_0557 frequently present solubility challenges. Consider these approaches:

  • Expression Optimization:

    • Reduce expression temperature (16-18°C)

    • Use lower inducer concentrations

    • Select specialized E. coli strains (C41/C43, designed for membrane proteins)

  • Solubilization Strategies:

    • Screen detergent panel (DDM, LDAO, CHAPS at various concentrations)

    • Test mixed micelle systems (detergent combinations)

    • Evaluate amphipols or nanodiscs for stable membrane protein environments

  • Fusion Partner Approaches:

    • MBP fusion (highly soluble carrier)

    • SUMO fusion (enhances folding)

    • Thioredoxin fusion (stabilizes disulfide bonds)

  • Buffer Optimization:

    • Screen pH ranges (typically 6.5-8.5)

    • Test various salt concentrations (100-500 mM)

    • Include stabilizing additives (glycerol, arginine, trehalose)
      Systematic screening using small-scale expression tests can identify optimal conditions before scaling up production.

How can researchers troubleshoot inconsistent experimental results with BCA_0557?

When facing reproducibility challenges:

  • Protein Quality Assessment:

    • Verify batch-to-batch consistency via SDS-PAGE

    • Confirm protein integrity using mass spectrometry

    • Assess aggregation state with dynamic light scattering

    • Test functional activity using established assays

  • Storage and Handling Variables:

    • Standardize freeze-thaw protocols

    • Implement consistent aliquoting procedures

    • Monitor storage conditions (temperature logs)

    • Verify buffer composition accuracy

  • Experimental Design Considerations:

    • Increase technical and biological replicates

    • Include internal standards across experiments

    • Blind sample analysis where feasible

    • Document all experimental parameters meticulously

  • Environmental Factors:

    • Control laboratory temperature fluctuations

    • Standardize incubation equipment calibration

    • Use consistent reagent sources

    • Consider circadian timing of experiments
      Creating a detailed standard operating procedure (SOP) for each experimental protocol involving BCA_0557 can significantly improve reproducibility across research groups.

How might BCA_0557 research inform novel antimicrobial strategies?

Understanding BCA_0557's structure and function could contribute to antimicrobial development through several mechanisms:

  • Target-Based Drug Design:

    • If essential for viability, BCA_0557 could serve as a direct therapeutic target

    • Structure-based virtual screening to identify potential inhibitors

    • Fragment-based approaches to develop highly specific ligands

  • Virulence Inhibition:

    • If involved in pathogenicity but not essential growth, targeting BCA_0557 could reduce virulence without selecting for resistance

    • Anti-virulence approaches represent an emerging strategy in antimicrobial development

  • Diagnostic Applications:

    • Development of antibodies against BCA_0557 for rapid B. cereus detection

    • Creation of biosensors for food safety applications

    • Distinction between pathogenic and non-pathogenic strains

  • Vaccine Development:

    • Assessment of BCA_0557 as a potential vaccine antigen

    • Evaluation in animal models of B. cereus infection

    • Combination with other virulence factors for multivalent protection
      Given the increasing antibiotic resistance observed in B. cereus isolates , novel therapeutic approaches targeting proteins like BCA_0557 represent important research directions.

What interdisciplinary approaches show promise for advancing BCA_0557 research?

Progress in understanding BCA_0557 will likely require cross-disciplinary collaboration:

  • Systems Biology Integration:

    • Network analysis placing BCA_0557 in broader cellular contexts

    • Multi-omics approaches (proteomics, transcriptomics, metabolomics)

    • Mathematical modeling of membrane protein dynamics

  • Synthetic Biology Applications:

    • Protein engineering to enhance favorable properties

    • Creation of minimal systems to study specific functions

    • Development of biosensors utilizing BCA_0557 properties

  • Computational-Experimental Synergy:

    • Machine learning to predict protein-protein interactions

    • Molecular dynamics simulations of membrane insertion

    • AI-assisted design of protein variants with enhanced properties

  • Translational Research:

    • Field applications in food safety monitoring

    • Clinical studies examining BCA_0557 as a biomarker

    • Agricultural applications for crop protection

  • Advanced Imaging Techniques:

    • Super-resolution microscopy to visualize cellular localization

    • Correlative light and electron microscopy for structural context

    • In situ structural studies using electron tomography
      These interdisciplinary approaches can collectively address the complex questions surrounding UPF0295 protein biology and its relevance to B. cereus pathogenicity.

How should researchers interpret apparent contradictions in BCA_0557 experimental data?

When faced with contradictory results:

  • Systematic Variation Analysis:

    • Stratify results by experimental conditions

    • Look for patterns related to protein batch, buffer composition, or experimental timing

    • Consider whether contradictions reflect biological heterogeneity rather than experimental error

  • Multifactorial Explanation:

    • Consider that BCA_0557 may have multiple functions under different conditions

    • Evaluate whether post-translational modifications affect results

    • Assess if protein-protein interactions vary contextually

  • Methodological Limitations:

    • Different techniques may access different protein states or conformations

    • In vitro conditions may not reflect in vivo reality

    • Recombinant protein may differ from native form

  • Resolution Strategies:

    • Design experiments specifically to address contradictions

    • Implement orthogonal methods to validate findings

    • Consider collaborative replication in independent laboratories
      The evolutionary relationships between B. cereus strains, revealed through multilocus sequence typing, show considerable genetic diversity with 192 different sequence types identified among 368 isolates . This genetic diversity may explain functional variation of proteins like BCA_0557 across strains.

What statistical approaches are most appropriate for BCA_0557 experimental data analysis?

The choice of statistical methods should align with experimental design and data characteristics:

Data TypeRecommended Statistical ApproachesImplementation Notes
Binding AffinityNon-linear regression (Kd determination)Compare one-site vs. two-site binding models
Activity AssaysANOVA with post-hoc testsInclude proper controls for multiple comparisons
Time-Course DataRepeated measures analysisAccount for temporal autocorrelation
Multi-Variable ExperimentsMultivariate analysis, PCAIdentify key variables driving observed effects
High-Throughput ScreensFDR correction for multiple testingBalance false positives and false negatives
For all statistical analyses:

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.