Recombinant Bacillus cereus UPF0295 protein BCAH187_A0594 (BCAH187_A0594)

Shipped with Ice Packs
In Stock
Cat. No.
BT2431598
Source
in vitro E.coli expression system
Synonyms
BCAH187_A0594; UPF0295 protein BCAH187_A0594
Quick Inquiry

Description

Production and Purification

BCAH187_A0594 is produced recombinantly in Escherichia coli, leveraging bacterial expression systems for high yield and scalability. Critical production parameters include:

ParameterSpecification
Expression SystemE. coli
TagN-terminal His-tag
Purity>90% (SDS-PAGE verified)
FormLyophilized powder
Storage BufferTris/PBS-based buffer with 6% trehalose (pH 8.0)
Reconstitution Guidance0.1–1.0 mg/mL in sterile water, with glycerol (5–50%) for long-term storage

The protein is stable at -20°C/-80°C but sensitive to repeated freeze-thaw cycles . Its lyophilized form ensures extended shelf life (12 months) .

Strain Context: Bacillus cereus AH187

B. cereus AH187 is a clinically relevant strain phylogenetically close to B. anthracis . Key traits of the strain include:

  • Pathogenicity: Produces cereulide, a heat-stable emetic toxin linked to food poisoning .

  • Surface Proteins: Features an S-layer composed of SL2 (BCAH187_A1064) and EA1 (BCAH187_A1065), which modulate adhesion and environmental resilience .

  • Regulatory Networks: S-layer protein expression is governed by Spo0A and CcpA, linking surfaceome dynamics to nutrient availability and developmental stages .

While BCAH187_A0594 is distinct from SL2/EA1, its recombinant form may aid in elucidating auxiliary surface-associated mechanisms in B. cereus.

Comparative Analysis of Recombinant Bacillus Proteins

ProteinExpression HostTagApplicationReference
BCAH187_A0594E. coliHisStructural/functional studies
BC3706E. coliHisImmunoblotting, ELISA
BCERE0007_RS18690E. coliHisEnzyme activity assays

Challenges and Future Directions

Current limitations include:

  • Unclear biological role of BCAH187_A0594 in B. cereus physiology.

  • Limited proteomic or transcriptomic data linking it to virulence pathways.

Future studies could explore:

  • Knockout mutants to assess phenotypic impacts.

  • Proteomic profiling under stress conditions (e.g., nutrient deprivation).

Product Specs

Form
Lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notification and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during the production process. If a specific tag type is required, please inform us for preferential development.
Synonyms
BCAH187_A0594; UPF0295 protein BCAH187_A0594
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-118
Protein Length
full length protein
Species
Bacillus cereus (strain AH187)
Target Names
BCAH187_A0594
Target Protein Sequence
MSIKYSNKINKIRTFALSLVFIGLFIAYLGVFFRENIIIMTTFMMVGFLAVIASTVVYFW IGMLSTKTVQIICPSCDKPTKMLGRVDACMHCNQPLTMDRNLEGKEFDEKYNKKSYKS
Uniprot No.
B7HU73

Target Background

Database Links

KEGG: bcr:BCAH187_A0594

Protein Families
UPF0295 family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *

Category

Service

THE BIOTEK
THE BioTek is a global biotech company offering highly purified proteins for research in cancer, apoptosis, development, endocrinology, immunology, neuroscience, proteases, and stem cells.
  • Contact
  • Address: 1925 E Maple Ave, El Segundo, CA 90245 United States
  • Phone : +1 201-285-7826
  • Email : info@thebiotek.com
  • Hours : Mon.-Fri. 9:00 AM - 5:00 PM
© Copyright 2025 TheBiotek. All Rights Reserved.