Recombinant Bacillus cereus UPF0295 protein BCB4264_A0544 (BCB4264_A0544)

What is the basic structural information of the UPF0295 protein BCB4264_A0544?

The UPF0295 protein BCB4264_A0544 from Bacillus cereus strain B4264 is a full-length protein consisting of 118 amino acids. Its complete amino acid sequence is: MSIKYSNKINKIRTFALSLVFIGLFIAYLGVFFRENIIIMTTFMMVGFLAVIASTVVYFWIGMLSTKTIQI ICPSCDKPTKMLGRVDACMHCNQPLTLDRDLEGKEFDEKYNNKKSYKS . The protein is identified in UniProt database with the accession number B7H9T4 . Sequence analysis suggests membrane-spanning regions, indicated by the hydrophobic amino acid stretches, which may be relevant to its potential role in cellular functions.

How does UPF0295 protein BCB4264_A0544 compare with other UPF0295 family proteins?

The UPF0295 family includes similar proteins across different Bacillus cereus strains. For example, the UPF0295 protein BCAH820_0521 (UniProt ID: B7JNH3) shares high sequence homology with BCB4264_A0544 . When comparing their sequences, minor variations can be observed:

What are the optimal storage and handling conditions for recombinant UPF0295 protein BCB4264_A0544?

For optimal stability, recombinant UPF0295 protein BCB4264_A0544 should be stored at -20°C, and for extended storage, conserved at -20°C or -80°C. The protein is typically supplied in a Tris-based buffer with 50% glycerol optimized for protein stability . For working solutions, it's recommended to store aliquots at 4°C for up to one week to minimize freeze-thaw cycles that can compromise protein integrity . When reconstituting lyophilized protein, researchers should:

• Briefly centrifuge the vial before opening

• Reconstitute in deionized sterile water to 0.1-1.0 mg/mL

• Add glycerol to a final concentration of 5-50% for long-term storage

• Prepare single-use aliquots to avoid repeated freeze-thaw cycles

What expression systems are most effective for producing recombinant UPF0295 protein?

Recombinant UPF0295 proteins from Bacillus cereus strains are most commonly expressed in E. coli expression systems . While the specific expression conditions for BCB4264_A0544 are not explicitly detailed in the search results, related UPF0295 proteins such as BCAH820_0521 are successfully expressed in E. coli with N-terminal His-tags . The expression system selection should consider:

• Codon optimization for E. coli

• Appropriate fusion tags for purification (His-tag is commonly used)

• Induction conditions optimized for membrane-associated protein expression

• Lysis and purification protocols that maintain the native conformation
  Researchers should verify protein purity using SDS-PAGE, with commercial preparations typically achieving >90% purity .

How can researchers investigate the potential role of UPF0295 protein in B. cereus pathogenicity?

To investigate UPF0295 protein's potential role in pathogenicity, researchers should employ a multi-faceted approach:

• Gene knockout studies: Create UPF0295 gene deletion mutants in B. cereus and compare virulence with wild-type strains

• Transcriptomic analysis: Examine UPF0295 expression levels under conditions that induce toxin production

• Protein interaction studies: Identify binding partners using pull-down assays or yeast two-hybrid screening

• Structural analysis: Determine if UPF0295 shares structural motifs with known virulence factors
  Context is important: B. cereus is known to harbor multiple toxin genes including enterotoxin genes (hblC, cytK, nheA, and entFM) and emetic toxin genes (ces and CER) . Research with other B. cereus strains shows that 90.2% of isolates contain at least one enterotoxin gene , suggesting a complex virulence network in which UPF0295 might participate.

What bioinformatic approaches are most useful for predicting UPF0295 protein function?

Given the limited functional characterization of UPF0295 proteins, comprehensive bioinformatic analysis is crucial:

• Homology modeling: Generate structural models based on proteins with similar sequences

• Domain prediction: Identify functional domains using tools like InterPro, Pfam

• Subcellular localization prediction: Determine likely cellular location using SignalP, TMHMM

• Phylogenetic analysis: Compare with UPF0295 proteins across bacterial species

• Structural prediction: Use AlphaFold or similar tools to predict 3D structure
  The amino acid sequence of BCB4264_A0544 suggests membrane-spanning regions based on its hydrophobic stretches (FALSLVFIGLFIAYLGVFFRE), which may indicate membrane localization or transport functions .

How should researchers design control experiments when studying UPF0295 protein function?

Robust control experiments are essential for functional studies of poorly characterized proteins like UPF0295:

• Positive and negative controls: Include well-characterized proteins with known functions alongside UPF0295

• Empty vector controls: For expression studies, include cells with the expression vector lacking the UPF0295 gene

• Complementation experiments: After gene knockout, reintroduce the UPF0295 gene to confirm phenotype restoration

• Tagged protein controls: When using tagged versions of UPF0295, verify tag effects with control proteins

• Cross-strain validation: Test findings across multiple B. cereus strains to confirm conserved functions
  Researchers should be aware that B. cereus shows variable antibiotic resistance profiles, with nearly universal resistance to β-lactam antibiotics (98%) but high susceptibility to gentamicin (100%) and clindamycin (97%) . This information is valuable when designing selection markers for genetic experiments.

What considerations are important when designing protein-protein interaction studies for UPF0295?

When investigating protein-protein interactions involving UPF0295:

• Native conditions: Maintain physiologically relevant buffer conditions with appropriate ionic strength

• Membrane protein handling: Use appropriate detergents for solubilization while preserving native interactions

• Tag placement: Consider both N-terminal and C-terminal tagged versions to identify any interference with interactions

• Crosslinking approach: Use membrane-permeable crosslinkers for in vivo interaction capture

• Validation methods: Confirm interactions using multiple methodologies (co-IP, FRET, SPR)
  The hydrophobic regions in UPF0295 protein suggest potential membrane association, which requires special consideration in interaction studies to prevent false positives or negatives due to non-specific hydrophobic interactions .

How might UPF0295 proteins relate to the UPF pathway known in mRNA surveillance?

While the UPF0295 protein family shares a naming convention with the UPF (UP-Frameshift) proteins involved in nonsense-mediated mRNA decay (NMD), their relationship requires careful investigation:

What role might UPF0295 proteins play in antimicrobial resistance mechanisms?

Given B. cereus's notable antimicrobial resistance profile, potential connections between UPF0295 and resistance mechanisms warrant investigation:

• Expression analysis: Compare UPF0295 expression levels between resistant and susceptible strains

• Gene knockout impact: Evaluate changes in antibiotic susceptibility after UPF0295 deletion

• Membrane permeability: Test if UPF0295 affects cell envelope properties and drug penetration

• Efflux pump interaction: Investigate potential association with known efflux mechanisms
  B. cereus isolates show high resistance to β-lactam antibiotics (98%), sulfamethoxazole/trimethoprim (97.5%), and rifampin (80%), while maintaining susceptibility to gentamicin (100%) and clindamycin (97%) . If UPF0295 influences membrane permeability or efflux systems, it could contribute to this resistance profile.

What approaches can overcome challenges in studying membrane-associated proteins like UPF0295?

Membrane-associated proteins present specific technical challenges:

• Solubilization strategies:

  • Use mild detergents like DDM or CHAPS

  • Consider native nanodiscs or amphipols for maintaining native structure

  • Test detergent screening panels to identify optimal conditions

• Expression optimization:

  • Lower induction temperatures (16-20°C)

  • Use specialized E. coli strains designed for membrane protein expression

  • Consider cell-free expression systems

• Structural analysis alternatives:

  • Cryo-EM for structure determination without crystallization

  • Solid-state NMR for structural information in membrane environments

  • Limited proteolysis combined with mass spectrometry for domain mapping
    The hydrophobic regions in UPF0295 protein BCB4264_A0544 sequence suggest potential membrane association requiring these specialized approaches .

How can researchers differentiate between direct and indirect effects of UPF0295 in functional studies?

Establishing causality in functional studies requires careful experimental design:

• Temporal analysis: Use inducible expression systems to observe immediate versus delayed effects

• Dose-dependency: Establish correlation between UPF0295 expression levels and observed phenotypes

• Rescue experiments: Complement knockout strains with wild-type and mutant variants

• Direct binding assays: Use purified components to establish direct interactions

• In vivo proximity labeling: Employ BioID or APEX2 fusions to identify proximal proteins
  For interaction studies with other cellular components, researchers should implement appropriate controls to distinguish specific interactions from non-specific binding, particularly given the hydrophobic regions in UPF0295 that may promote non-specific associations .

How can UPF0295 research contribute to understanding B. cereus pathogenesis in extreme environments?

B. cereus has been isolated from extreme environments like spacecraft assembly facilities, demonstrating remarkable resilience . UPF0295 research may provide insights into survival mechanisms:

• Stress response correlation: Analyze UPF0295 expression under various environmental stressors

• Spore formation role: Investigate potential contributions to sporulation or germination

• Biofilm formation: Explore UPF0295 involvement in biofilm development in extreme conditions

• Cross-species comparison: Compare UPF0295 properties across strains from different extreme environments
  B. cereus isolates from spacecraft assembly facilities showed significant prevalence of toxin genes and antibiotic resistance . Understanding UPF0295's potential role in these phenotypes could provide insights into bacterial adaptation to extreme cleaning protocols and containment measures.

What potential biotechnological applications might emerge from UPF0295 protein research?

Beyond basic characterization, UPF0295 proteins may have biotechnological applications:

• Membrane protein engineering platform: If confirmed as membrane proteins, UPF0295 variants could serve as scaffolds for engineered membrane proteins

• Biosensor development: Potential applications in environmental monitoring if linked to stress responses

• Antimicrobial target: If essential for survival, could represent novel therapeutic targets

• Protein production tags: If secreted or surface-exposed, could be utilized as fusion partners for protein expression
  The apparent conservation of UPF0295 proteins across B. cereus strains suggests fundamental biological importance that could be leveraged for biotechnological applications once their function is better understood .