Recombinant Bacillus cereus UPF0295 protein BCE_0593 (BCE_0593)

Shipped with Ice Packs
In Stock

Description

Protein Characteristics

BCE_0593 is annotated as a UPF0295 family protein, a group with uncharacterized functions. Key features include:

ParameterValue/Description
Source OrganismBacillus cereus (strain ATCC 10987)
Expression HostE. coli
TagN-terminal His-tag
LengthFull-length (1–118 aa)
Molecular Weight~13 kDa (estimated from aa sequence)
SequenceMGIKYSNKINKIRTFALSLVFIGLFIAYLGVFFRENIIIMTTFMMVGFLAVIASTVVYFWIGMLSTKTVQIICPSCDKPTKMLGRVDACMHCNQPLTMDRNLEGKEFDEKYNKKSYKS

Production and Handling

The recombinant protein is supplied as a lyophilized powder stabilized in a Tris/PBS-based buffer with 6% trehalose (pH 8.0). Key handling guidelines include:

ParameterDetails
Storage-20°C or -80°C; aliquot to avoid repeated freeze-thaw cycles
ReconstitutionDissolve in deionized sterile water (0.1–1.0 mg/mL); add 50% glycerol for long-term storage
Purity>90% as verified by SDS-PAGE

Research Applications

While functional studies on BCE_0593 remain limited, its recombinant form is utilized in:

  • Antibody Production: Served as an antigen for generating specific antibodies (e.g., ELISA applications) .

  • Structural Analysis: Full-length expression facilitates studies on its tertiary structure and potential interactions.

  • Proteomic Studies: Used as a reference protein in workflows analyzing B. cereus exoproteomes or cellular pathways .

Data Gaps and Research Challenges

Despite its availability, critical gaps persist:

  1. Functional Role: No studies directly link BCE_0593 to B. cereus virulence, metabolism, or stress response.

  2. Homologs: Sequence alignment tools (e.g., BLAST) reveal limited similarity to characterized proteins, suggesting a novel or niche function.

  3. Regulatory Context: Unlike B. cereus virulence factors (e.g., PlcR-regulated toxins), BCE_0593 lacks documented transcriptional regulation or quorum-sensing involvement .

Comparative Analysis with Related Proteins

BCE_0593 differs from well-characterized B. cereus proteins such as EntD (BC_3716), which regulates exoproteome composition and cytotoxicity . Unlike EntD, BCE_0593 has no annotated enzymatic activity or known role in pathogenesis.

ProteinFunctionLocalizationRegulation
BCE_0593UnknownCytoplasmic (inferred)Not documented
EntDExoproteome regulation, virulenceExoproteinPlcR-dependent
IlsAIron acquisition (surface protein)Cell surfaceIron-regulated

Product Specs

Form
Lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default glycerol concentration is 50% and can serve as a guideline.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.
If you require a specific tag, please inform us; we will prioritize developing it to your specifications.
Synonyms
BCE_0593; UPF0295 protein BCE_0593
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-118
Protein Length
full length protein
Species
Bacillus cereus (strain ATCC 10987 / NRS 248)
Target Names
BCE_0593
Target Protein Sequence
MGIKYSNKINKIRTFALSLVFIGLFIAYLGVFFRENIIIMTTFMMVGFLAVIASTVVYFW IGMLSTKTVQIICPSCDKPTKMLGRVDACMHCNQPLTMDRNLEGKEFDEKYNKKSYKS
Uniprot No.

Target Background

Database Links

KEGG: bca:BCE_0593

Protein Families
UPF0295 family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is BCE_0593 and how is it classified?

BCE_0593 is classified as an uncharacterized protein family 0295 (UPF0295) protein from Bacillus cereus. The UPF designation indicates that while the protein has been identified through genomic sequencing, its biological function remains largely unknown. The protein consists of 118 amino acids and is available as a recombinant full-length protein with histidine tag expression systems . The protein is encoded within the genome of Bacillus cereus, a Gram-positive, rod-shaped, spore-forming bacterium that is widely distributed in the environment and known for causing food poisoning and other infections .

What is the molecular structure of BCE_0593?

While the complete three-dimensional structure of BCE_0593 has not been fully elucidated in the provided research materials, researchers can predict structural elements using bioinformatics approaches. As a methodology for researchers interested in BCE_0593 structure, begin with homology modeling using related UPF0295 family proteins with known structures as templates. Follow with circular dichroism spectroscopy to determine secondary structure content (α-helices, β-sheets). For tertiary structure analysis, consider X-ray crystallography or NMR spectroscopy, which would require expression and purification of the recombinant protein with proper folding verification. Computational tools like AlphaFold can provide initial structural predictions that guide experimental design.

How is recombinant BCE_0593 typically produced and purified?

Recombinant BCE_0593 can be expressed as a His-tagged protein in E. coli expression systems . For optimal production, researchers should follow this methodological approach:

  • Clone the BCE_0593 gene into an appropriate expression vector with a histidine tag

  • Transform into E. coli expression strains (BL21(DE3) or derivatives)

  • Optimize expression conditions (temperature, IPTG concentration, induction time)

  • Lyse cells using methods appropriate for bacterial proteins (sonication or French press)

  • Purify using immobilized metal affinity chromatography (IMAC) with Ni-NTA resin

  • Consider secondary purification steps like ion exchange or size exclusion chromatography

  • Verify protein purity using SDS-PAGE and identity using Western blotting

  • Assess protein folding using circular dichroism or fluorescence spectroscopy

The exact conditions may need optimization for maximum yield and proper folding.

What experimental approaches are recommended to determine BCE_0593 function?

Determining the function of an uncharacterized protein like BCE_0593 requires a multi-faceted approach:

  • Bioinformatic analysis: Perform sequence-based homology searches and structural predictions to identify potential functional domains or motifs

  • Gene knockout studies: Generate BCE_0593 deletion mutants in B. cereus to assess phenotypic changes in growth, survival, or virulence

  • Protein-protein interaction studies: Use pull-down assays, yeast two-hybrid, or co-immunoprecipitation to identify binding partners

  • Transcriptomic analysis: Compare gene expression profiles between wild-type and BCE_0593 mutant strains under various conditions

  • Biochemical assays: Test for enzymatic activities based on bioinformatic predictions

  • Structural studies: Determine three-dimensional structure to infer function

  • Complementation studies: Express BCE_0593 in knockout strains to confirm phenotype restoration

  • Heterologous expression: Express BCE_0593 in other bacterial species to assess impact

Each approach provides complementary information that can collectively reveal functional insights.

Could BCE_0593 play a role in B. cereus pathogenicity mechanisms?

While direct evidence linking BCE_0593 to B. cereus virulence is not explicitly mentioned in the available research, this possibility warrants investigation considering the pathogenic nature of B. cereus. The pathogenicity of B. cereus is primarily associated with various tissue-destructive exoenzymes and toxins, including hemolysins, phospholipases, emesis-inducing toxin, and proteases . The major toxins include the tripartite enterotoxins Hbl (hemolysin BL) and Nhe (non-hemolytic enterotoxin), which require the sequential assembly of three protein components to form pores in target cell membranes .

Research methodology to assess potential virulence association:

  • Compare BCE_0593 expression levels during different growth phases and under conditions mimicking host environments

  • Analyze BCE_0593 expression in response to quorum sensing molecules that regulate virulence factor expression

  • Test BCE_0593 deletion mutants in infection models to assess impact on virulence

  • Investigate possible interactions between BCE_0593 and known virulence factors

  • Examine co-regulation of BCE_0593 with virulence genes in transcriptomic data

What is known about the regulation of BCE_0593 expression?

  • Promoter analysis: Identify BCE_0593 promoter elements and potential regulatory binding sites

  • Reporter gene assays: Fuse the BCE_0593 promoter to reporter genes (gfp, lacZ) to monitor expression under different conditions

  • Transcription factor identification: Use DNA pull-down assays or yeast one-hybrid systems to identify proteins that bind the BCE_0593 promoter

  • Response to environmental stimuli: Measure BCE_0593 expression under various conditions (pH, temperature, nutrient availability, osmolarity)

  • Epigenetic regulation: Investigate potential DNA methylation patterns affecting BCE_0593 expression

  • Small RNA regulation: Identify potential small RNAs that might regulate BCE_0593 expression post-transcriptionally

Given that B. cereus toxin expression is often regulated by quorum sensing , investigating whether BCE_0593 is similarly controlled would be valuable.

How does BCE_0593 compare across different B. cereus strains and related species?

Investigating BCE_0593 conservation could provide insights into its functional importance. The B. cereus group comprises several closely related species including B. anthracis, B. thuringiensis, B. mycoides, B. pseudomycoides, and B. cytotoxicus . A methodological approach for comparative analysis includes:

  • Perform BLAST searches to identify BCE_0593 homologs across the B. cereus group

  • Conduct multiple sequence alignments to identify conserved residues

  • Construct phylogenetic trees to understand evolutionary relationships

  • Compare genomic context to identify conserved synteny or operon structures

  • Analyze selection pressure using dN/dS ratios to identify functionally important residues

  • Examine strain-specific variations and correlate with phenotypic differences

This comparative approach could reveal whether BCE_0593 is part of the core genome or accessory genome, and whether its sequence conservation correlates with specific bacterial characteristics.

What cellular processes might involve BCE_0593 based on genomic context?

Genomic context analysis can provide clues about BCE_0593 function. While the search results don't provide specific information about genes adjacent to BCE_0593, researchers can:

  • Analyze the genomic neighborhood of BCE_0593 to identify co-localized genes

  • Investigate whether BCE_0593 is part of an operon structure

  • Examine whether flanking genes have known functions that might suggest a role for BCE_0593

  • Compare genomic context across multiple B. cereus strains to identify conserved arrangements

  • Look for regulatory elements that might control BCE_0593 along with adjacent genes

  • Search for similar genomic contexts in other bacterial species

What are the challenges in studying BCE_0593 function and how can they be addressed?

Investigating uncharacterized proteins like BCE_0593 presents several challenges:

  • Lack of known functional domains: Use sensitive sequence analysis tools like HHpred or structure prediction tools like AlphaFold to identify potential functional domains

  • Possibility of redundant function: Generate multiple gene knockouts of functionally related genes

  • Conditional expression: Examine BCE_0593 function under diverse environmental conditions that might trigger its activity

  • Low expression levels: Optimize detection methods using sensitive techniques like qPCR or targeted proteomics

  • Protein stability issues: Optimize buffer conditions and consider fusion tags that enhance stability

  • Lack of suitable assays: Develop high-throughput screening approaches to test various potential functions

  • Potential essentiality: Use conditional knockdown strategies if direct knockout is lethal

A systematic approach combining computational predictions with targeted experimental validation offers the best strategy for functional characterization.

What techniques are most effective for studying potential protein-protein interactions involving BCE_0593?

Understanding BCE_0593's interaction partners could provide crucial functional insights. Methodological approaches include:

TechniqueAdvantagesLimitationsBest Application
Pull-down assays with His-tagged BCE_0593Direct identification of binding partners; compatible with mass spectrometryPotential for non-specific binding; requires optimized conditionsInitial screening of interaction partners in cell lysates
Yeast two-hybridIn vivo detection; can screen librariesHigh false positive rate; requires nuclear localizationScreening for direct binary interactions
Bacterial two-hybridSuitable for bacterial proteins; in vivo detectionLimited to binary interactionsVerification of specific interactions in bacterial systems
Co-immunoprecipitationDetects interactions in native conditionsRequires specific antibodies; may miss transient interactionsConfirmation of interactions in B. cereus cells
Surface plasmon resonanceQuantitative binding kinetics; label-freeRequires purified proteins; surface immobilization may affect bindingDetailed characterization of confirmed interactions
Crosslinking mass spectrometryCan capture transient interactions; identifies binding interfacesComplex data analysis; chemical modifications requiredMapping interaction interfaces at amino acid resolution
Fluorescence resonance energy transfer (FRET)Real-time monitoring in live cellsRequires fluorescent tagging; potential tag interferenceStudying dynamics of interactions in living bacteria
Protein complementation assaysHigh sensitivity for in vivo detectionPotential structural constraintsVerification of interactions in bacterial cells

A combination of at least two complementary techniques is recommended for reliable results.

How can researchers investigate potential roles of BCE_0593 in stress response or survival mechanisms?

B. cereus is known for its adaptability to various environmental stresses, and BCE_0593 might play a role in these processes. To investigate this possibility:

  • Expose wild-type and BCE_0593 mutant strains to various stressors:

    • Heat shock (42-55°C)

    • Oxidative stress (H₂O₂, paraquat)

    • Acid stress (pH 2-5)

    • Osmotic stress (high salt concentrations)

    • Nutrient limitation

    • Antimicrobial compounds

  • Measure survival rates, growth kinetics, and morphological changes

  • Perform transcriptomic and proteomic analyses to identify stress-responsive pathways affected by BCE_0593 deletion

  • Monitor BCE_0593 expression levels under stress conditions using qRT-PCR

  • Assess spore formation efficiency and resistance properties in BCE_0593 mutants compared to wild-type

  • Examine potential changes in cell envelope properties since many UPF proteins affect membrane or cell wall functions

This systematic stress challenge approach could reveal conditions where BCE_0593 becomes particularly important for bacterial survival.

How might BCE_0593 research contribute to understanding B. cereus pathogenesis?

While BCE_0593's specific role in pathogenesis is unknown, investigating this protein could contribute to understanding B. cereus virulence in several ways:

  • Potential virulence regulation: BCE_0593 could be involved in regulating known virulence factors like the Hbl and Nhe tripartite enterotoxins

  • Host-pathogen interactions: BCE_0593 might participate in bacterial adaptation to host environments

  • Stress response during infection: BCE_0593 could help bacteria cope with host defense mechanisms

  • Biofilm formation: If involved in biofilm processes, BCE_0593 could affect persistence during infection

  • Spore properties: Potential roles in sporulation could impact transmission and resistance

  • Metabolic adaptation: BCE_0593 might facilitate metabolic adjustments required during infection

Research methodologies should include infection models (cell culture and animal) comparing wild-type and BCE_0593 mutant strains, analyzing virulence factor production, and examining host response patterns.

What approaches should be used to resolve contradictory findings about BCE_0593 function?

When facing contradictory results regarding BCE_0593 function, researchers should implement a systematic troubleshooting approach:

  • Strain verification: Confirm genetic identity of bacterial strains used in different studies

  • Experimental condition standardization: Develop detailed protocols that specify media composition, growth conditions, and analytical methods

  • Genetic complementation: Verify that phenotypes can be restored by reintroducing BCE_0593

  • Independent validation: Have different research groups reproduce key findings using the same protocols

  • Strain background effects: Test BCE_0593 function in multiple B. cereus strains to identify strain-specific effects

  • Conditional functionality: Investigate whether BCE_0593 function depends on specific environmental conditions

  • Multi-method confirmation: Verify results using orthogonal experimental approaches

  • Effect size quantification: Use statistical analysis to determine the magnitude and significance of observed effects

This structured approach helps distinguish genuine biological complexity from experimental artifacts.

What are the most promising future research directions for BCE_0593?

Based on the current understanding of BCE_0593 and B. cereus biology, several research directions hold particular promise:

  • Structural biology: Determining the three-dimensional structure of BCE_0593 would provide valuable insights into potential functions

  • Systematic interaction mapping: Comprehensive identification of BCE_0593 protein and DNA interaction partners

  • Regulatory network analysis: Positioning BCE_0593 within the broader regulatory networks of B. cereus

  • Comparative genomics across the B. cereus group: Understanding evolutionary conservation patterns among closely related species

  • Function in non-pathogenic versus pathogenic contexts: Comparing roles in environmental survival versus host infection

  • Potential as a therapeutic target: If found to be important for virulence or survival, exploring BCE_0593 as a potential target for novel antimicrobials

  • Integration with systems biology approaches: Incorporating BCE_0593 research into comprehensive models of B. cereus physiology

These directions collectively would advance our understanding of this uncharacterized protein and potentially reveal new aspects of B. cereus biology and pathogenicity.

How does BCE_0593 research fit into the broader context of studying uncharacterized bacterial proteins?

BCE_0593 research exemplifies the challenges and opportunities in studying the bacterial "dark proteome" - proteins of unknown function that constitute a significant portion of bacterial genomes. This research is significant because:

  • Approximately 30-40% of genes in bacterial genomes encode proteins of unknown function, representing a vast reservoir of undiscovered biology

  • Uncharacterized proteins often play roles in species-specific adaptations and virulence mechanisms

  • Novel functions discovered in UPF proteins frequently reveal new biological processes and potential therapeutic targets

  • The methodologies developed for BCE_0593 characterization can serve as templates for studying other uncharacterized proteins

  • Integration of computational predictions with experimental validation represents a powerful approach for systematic functional discovery

  • Understanding BCE_0593 contributes to filling gaps in our knowledge of B. cereus biology, which has implications for food safety and clinical microbiology

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.