Recombinant Bacillus cereus UPF0295 protein BCE33L0445 (BCE33L0445)

What are the fundamental properties of BCE33L0445 protein?

Recombinant Bacillus cereus UPF0295 protein BCE33L0445 is a 118-amino acid protein from Bacillus cereus strain ZK/E33L with UniProt accession number Q63GA7. The protein belongs to the UPF0295 family, which consists of uncharacterized proteins with conserved domains. The amino acid sequence is MSIKYSNKINKIRTFALSLVFIGLFIAYLGVFFRENIIIMTTFMMVGFLAVIASTVVYFWIGMLSTKTVQIICPSCDKPTKMLGRVDACMHCNQPLTMDRNLEGKEFDEKYNKKSYKA, containing hydrophobic regions suggesting potential membrane association .

What are the optimal storage conditions for maintaining BCE33L0445 stability?

For optimal stability, store BCE33L0445 at -20°C for regular use or at -80°C for extended storage periods. The protein is typically provided in a Tris-based buffer containing 50% glycerol specifically optimized for this protein. Create working aliquots to prevent repeated freeze-thaw cycles that can compromise protein integrity. Working aliquots remain stable at 4°C for up to one week. To prevent degradation, always handle the protein on ice when preparing experimental samples and avoid exposing it to room temperature for extended periods .

What reconstitution protocols should be followed for lyophilized BCE33L0445?

When working with lyophilized BCE33L0445, first briefly centrifuge the vial to ensure all material is at the bottom. Reconstitute the protein in deionized sterile water to achieve a concentration of 0.1-1.0 mg/mL. For long-term storage of reconstituted protein, add glycerol to a final concentration of 5-50% (with 50% being optimal for maximum stability) and aliquot before storing at -20°C or -80°C. Document reconstitution date, buffer composition, and storage conditions in your laboratory notebook for experimental reproducibility .

How should controls be incorporated when studying BCE33L0445 function?

When designing experiments to study BCE33L0445 function, implement a comprehensive control strategy that includes both positive and negative controls. For protein-protein interaction studies, include a known interacting protein pair as a positive control. For negative controls, use both an unrelated protein of similar size and structure, and a buffer-only control. If studying potential enzymatic activity, include both enzyme-free and substrate-free controls. For functional assays, consider using a closely related protein from the UPF0295 family from a different Bacillus species for comparative analysis. This experimental design approach strengthens causal inferences about BCE33L0445 function by systematically eliminating alternative explanations for observed effects .

What experimental approaches are suitable for characterizing the membrane association of BCE33L0445?

Based on the protein sequence containing hydrophobic regions, a multi-method approach is recommended to characterize potential membrane association. Begin with computational prediction using algorithms such as TMHMM, Phobius, and TOPCONS to identify putative transmembrane domains. Follow with subcellular fractionation experiments comparing cytosolic, membrane, and nuclear fractions via Western blotting. Further validate findings using fluorescence microscopy with BCE33L0445 fused to a fluorescent tag such as GFP. For definitive characterization, perform membrane extraction assays using increasing concentrations of detergents (0.1-1% Triton X-100, n-dodecyl β-D-maltoside, or CHAPS) to distinguish between peripheral and integral membrane proteins. Comparative analysis across these methods provides robust evidence of the protein's membrane association characteristics .

How can researchers design experiments to investigate potential BCE33L0445 involvement in bacterial stress responses?

To investigate BCE33L0445's potential role in bacterial stress responses, implement a factorial experimental design that systematically evaluates protein expression and activity under various stress conditions. Expose Bacillus cereus cultures to a matrix of stressors including oxidative stress (H₂O₂, 0.1-5 mM), osmotic stress (NaCl, 0.5-2.5 M), pH stress (pH 4-9), temperature stress (10-55°C), and nutrient limitation. Measure BCE33L0445 expression levels using RT-qPCR and Western blotting at multiple time points (15 min, 30 min, 1 h, 2 h, 4 h post-stress). Create BCE33L0445 knockout and overexpression strains to assess phenotypic changes in stress survival. Compare stress response profiles between wild-type and modified strains using growth curves, viability assays, and metabolomic profiling. This comprehensive approach allows for identifying specific stress conditions where BCE33L0445 plays a significant functional role .

What are the recommended expression systems for producing high-quality BCE33L0445?

For optimal expression of recombinant BCE33L0445, E. coli-based systems typically provide good yields and proper folding. The BL21(DE3) strain is recommended for basic expression, while Rosetta or Origami strains may improve expression if rare codons or disulfide bonds are present in the protein. Expression vectors containing T7 or tac promoters with an N-terminal His-tag facilitate purification while maintaining protein function. Expression conditions should be optimized by testing multiple parameters: IPTG concentrations (0.1-1.0 mM), induction temperatures (16°C, 25°C, 37°C), and induction durations (3h, 6h, overnight). For proteins proving difficult to express in E. coli, consider alternative systems such as Bacillus subtilis or insect cell expression systems (Sf9 or Hi5 cells with baculovirus vectors) .

What purification strategy yields the highest purity BCE33L0445 preparations?

A multi-step purification strategy is recommended to achieve >90% purity of BCE33L0445. Begin with affinity chromatography using Ni-NTA for His-tagged protein or glutathione sepharose for GST-tagged constructs. For His-tagged BCE33L0445, use a binding buffer containing 50 mM Tris-HCl pH 8.0, 300 mM NaCl, and 10 mM imidazole, followed by washing with increasing imidazole concentrations (20-40 mM) and elution with 250 mM imidazole. Further purify using ion-exchange chromatography (typically Q-Sepharose at pH 8.0) followed by size-exclusion chromatography using a Superdex 75 or 200 column. Assess purity at each step using SDS-PAGE and Western blotting. Final preparations should achieve >90% purity as determined by SDS-PAGE with Coomassie or silver staining .

How can researchers troubleshoot low expression yields of BCE33L0445?

When encountering low expression yields of BCE33L0445, implement a systematic troubleshooting approach. First, optimize codon usage by analyzing the coding sequence for rare codons in the expression host and either using a codon-optimized synthetic gene or switching to a host strain supplying rare tRNAs (such as Rosetta). Second, evaluate protein toxicity by monitoring bacterial growth curves after induction - if toxicity is observed, reduce IPTG concentration (to 0.1-0.2 mM) and lower induction temperature (to 16-20°C). Third, assess protein solubility by comparing whole-cell lysate with soluble and insoluble fractions via SDS-PAGE - if primarily insoluble, modify buffer conditions by adding solubilizing agents (0.1% Triton X-100, 5-10% glycerol, or 50-300 mM NaCl). Finally, consider fusion partners such as MBP, SUMO, or Trx that can enhance solubility. Document all optimization attempts in a structured matrix to identify the combination of conditions yielding maximum soluble protein .

What bioinformatic approaches can predict potential functions of BCE33L0445?

For comprehensive functional prediction of BCE33L0445, integrate multiple bioinformatic approaches. Begin with sequence-based analyses using BLAST against non-redundant protein databases to identify homologs with known functions. Perform multiple sequence alignment of UPF0295 family members across bacterial species using MUSCLE or CLUSTALW to identify conserved residues that may indicate functional importance. Apply structure prediction tools such as AlphaFold2 or I-TASSER to generate three-dimensional models for identifying potential binding pockets or catalytic sites. Utilize protein domain databases (Pfam, SMART, InterPro) to identify functional domains. Employ genomic context analysis to examine neighboring genes in the Bacillus cereus genome, as functionally related genes are often co-located or co-expressed. Finally, use gene ontology enrichment analysis on proteins with similar expression patterns to predict biological processes BCE33L0445 may participate in .

How can researchers design assays to investigate potential protein-protein interactions involving BCE33L0445?

To investigate protein-protein interactions involving BCE33L0445, implement a multi-tiered experimental approach. Begin with in silico prediction using tools like STRING, PrePPI, or Interologous Interaction Database to identify potential interaction partners based on genomic context, co-expression, and homology to known interacting proteins. Then employ a pull-down assay using His-tagged BCE33L0445 as bait coupled with mass spectrometry to identify potential interacting proteins from Bacillus cereus lysates. Validate high-confidence candidates using reciprocal co-immunoprecipitation assays. For detailed interaction characterization, utilize biophysical methods including surface plasmon resonance (SPR) to determine binding kinetics (kon, koff, and KD values), and isothermal titration calorimetry (ITC) to measure thermodynamic parameters (ΔH, ΔS, and ΔG). Finally, confirm the biological relevance of identified interactions using bacterial two-hybrid systems or fluorescence resonance energy transfer (FRET) assays in live cells .

What methods can assess the potential role of BCE33L0445 in bacterial pathogenesis?

To investigate BCE33L0445's potential role in pathogenesis, implement a multi-level experimental strategy. First, create gene deletion and complementation strains using CRISPR-Cas9 or allelic exchange techniques. Compare these strains in infection models including human cell lines (e.g., macrophages, epithelial cells) and invertebrate models (Galleria mellonella, Caenorhabditis elegans). Measure survival rates, bacterial proliferation, and host responses (cytokine production, ROS generation) across these models. Perform transcriptomic analysis (RNA-seq) comparing wild-type and mutant strains during infection to identify differentially regulated virulence pathways. Additionally, assess BCE33L0445's impact on critical virulence phenotypes including biofilm formation (crystal violet assay), motility (swimming and swarming assays), and toxin production (ELISA or Western blotting for known B. cereus toxins). For mechanistic insights, evaluate the protein's potential role in stress resistance during infection by exposing bacterial strains to host-relevant stressors including reactive oxygen species, antimicrobial peptides, and pH shifts .

How does BCE33L0445 compare structurally and functionally with other UPF0295 family proteins?

Comparative analysis reveals both conservation and divergence among UPF0295 family proteins. BCE33L0445 from B. cereus strain ZK/E33L shares significant sequence similarity (>90%) with the UPF0295 protein BCAH820_0521 (UniProt ID: B7JNH3) from other B. cereus strains but shows greater divergence (40-60% identity) with UPF0295 homologs from other Bacillus species. Structurally, all UPF0295 family members contain hydrophobic regions suggesting membrane association, and conserved cysteine residues that may form disulfide bridges or coordinate metal ions. The highest conservation occurs in the C-terminal region containing the CXXC motif (CPSC in BCE33L0445), potentially indicating a redox-active or metal-binding site. Functional comparison is limited by the uncharacterized nature of these proteins, but patterns of conservation suggest roles in membrane processes, stress responses, or redox homeostasis. The table below summarizes key comparative features of selected UPF0295 proteins :

How can researchers design experiments to investigate functional conservation between BCE33L0445 and its homologs?

To investigate functional conservation between BCE33L0445 and its homologs, implement a comprehensive comparative experimental framework. Begin with complementation studies by expressing BCE33L0445 in UPF0295 knockout strains of related Bacillus species to assess functional rescue. Design chimeric proteins by swapping domains between BCE33L0445 and homologs to identify regions responsible for specific functions. Perform site-directed mutagenesis targeting conserved residues, particularly within the CPSC motif, followed by functional assays to determine their importance. Compare protein-protein interaction networks across species using cross-species pull-down assays with tagged versions of each homolog. Conduct parallel phenotypic analyses of knockout strains across multiple species under identical stress conditions to identify conserved phenotypes. Finally, perform comparative transcriptomic analysis of cells overexpressing different UPF0295 homologs to identify common downstream effects. This integrated approach will reveal both conserved core functions and species-specific adaptations within the UPF0295 protein family .

How might BCE33L0445 be utilized in studying bacterial epigenetic reprogramming?

BCE33L0445 could potentially serve as a model protein for investigating bacterial epigenetic mechanisms, particularly in the context of adaptive responses. Researchers should design experiments that examine whether BCE33L0445 expression changes in response to environmental stressors and whether these changes persist across generations. Create reporter strains with the BCE33L0445 promoter fused to fluorescent proteins to monitor expression dynamics in real-time. Perform ChIP-seq analysis to identify potential transcription factors or nucleoid-associated proteins that bind to the BCE33L0445 promoter region under different conditions. Investigate potential roles in DNA methylation patterns by comparing methylomes of wild-type and BCE33L0445 knockout strains. Given that BCG vaccination induces epigenetic reprogramming in host cells through DNA methylation alterations, examine whether BCE33L0445 or its homologs in Mycobacteria contribute to these effects, potentially through bacterial-host protein interactions that influence host epigenetic machinery .

What considerations should guide the design of BCE33L0445 structural studies?

When designing structural studies for BCE33L0445, several considerations are crucial for success. First, optimize protein expression and purification to obtain milligram quantities of homogeneous, stable protein suitable for structural analysis. For X-ray crystallography, perform crystallization screening trials using commercial kits with varying precipitants, buffers, and additives at different temperatures (4°C and 20°C). Consider adding stabilizing agents such as glycerol (5-10%) or specific detergents (0.1% DDM or LDAO) if the hydrophobic regions cause aggregation issues. For NMR studies, prepare uniformly ¹⁵N- and ¹³C-labeled protein using minimal media with labeled precursors. Given the predicted membrane association, consider solution NMR in the presence of membrane mimetics such as detergent micelles (DPC or LMPG) or nanodiscs. For cryo-EM studies, particularly if BCE33L0445 forms larger complexes, optimize grid preparation conditions and consider GraFix gradient fixation to stabilize complexes. Complement structural data with molecular dynamics simulations to understand conformational flexibility and potential membrane interactions .

How can researchers design experiments to investigate BCE33L0445's potential role in bacterial immune responses?

To investigate BCE33L0445's potential role in bacterial immune responses, design a comprehensive experimental framework centered on trained immunity concepts. First, create BCE33L0445 knockout and overexpression strains in B. cereus. Compare these strains' ability to induce trained immunity in human monocytes by measuring cytokine production (IL-1β, TNF-α, IL-6) after primary exposure followed by secondary stimulation with heterologous pathogens. Analyze epigenetic modifications (H3K4me3, H3K27ac) and metabolic reprogramming (glycolysis, glutaminolysis) in monocytes exposed to wild-type versus modified bacterial strains. Perform single-cell RNA-seq on host cells to identify differential response patterns. Investigate whether BCE33L0445 directly interacts with host pattern recognition receptors using pull-down assays and surface plasmon resonance. Conduct proteomics analysis of BCE33L0445-exposed versus control monocytes to identify altered signaling pathways. Finally, determine if BCE33L0445 influences heterologous protection in vivo using mouse models of infection. This approach will reveal whether BCE33L0445 contributes to the documented ability of Bacillus species to modulate innate immune memory .

What strategies can address issues with BCE33L0445 protein aggregation during purification?

When encountering BCE33L0445 aggregation during purification, implement a systematic optimization strategy. First, modify lysis and purification buffers by testing various additives: detergents (0.1% Triton X-100, 0.05% DDM, or 0.1% CHAPS), osmolytes (5-10% glycerol, 0.5-1M sucrose, or 0.5-1M arginine), and reducing agents (5mM DTT or 5mM β-mercaptoethanol). Second, optimize purification temperature by performing all steps at 4°C and avoiding freeze-thaw cycles. Third, employ step-wise dialysis when removing imidazole or changing buffer conditions, with concentration increments not exceeding 2-fold per step. Fourth, consider on-column refolding for severely aggregated protein by denaturing the bound protein with 6M guanidine-HCl followed by gradual reduction of denaturant concentration. Fifth, use size-exclusion chromatography as a final step to separate aggregates from properly folded protein. Document all optimization attempts and resulting protein behavior in a systematic manner to identify the most effective combination of conditions .

How can researchers validate that recombinant BCE33L0445 maintains native conformation and function?

To validate that recombinant BCE33L0445 maintains its native conformation and function, employ a multi-method validation approach. First, perform circular dichroism (CD) spectroscopy to assess secondary structure elements and thermal stability by measuring spectra at 190-260 nm and conducting thermal denaturation experiments (20-90°C). Second, use intrinsic fluorescence spectroscopy to evaluate tertiary structure integrity by measuring tryptophan/tyrosine emission spectra (300-400 nm) and comparing with denatured controls. Third, analyze protein by native PAGE and size-exclusion chromatography to confirm appropriate oligomeric state. Fourth, if BCE33L0445's function becomes known, perform specific activity assays comparing recombinant protein with native protein extracted from B. cereus. Fifth, generate antibodies against recombinant BCE33L0445 and verify cross-reactivity with the native protein in B. cereus lysates. Finally, if membrane association is confirmed, verify proper membrane integration using liposome binding assays or proteoliposome reconstitution followed by protease protection assays to assess topology .

What approaches can resolve data inconsistencies in BCE33L0445 functional studies?

When encountering inconsistent data in BCE33L0445 functional studies, implement a structured resolution framework. First, standardize protein preparations by establishing rigorous quality control metrics including purity (>90% by SDS-PAGE), concentration (verified by multiple methods including Bradford assay and A280), and activity (using a reproducible functional assay once established). Second, control experimental variables by standardizing buffer compositions, incubation times, temperatures, and equipment calibration across experiments. Third, implement blind experimental design where researchers are unaware of sample identity during data collection and analysis to minimize bias. Fourth, increase statistical power by performing adequate biological replicates (minimum n=3) and technical replicates (minimum n=3) with appropriate statistical analysis. Fifth, validate findings using complementary methodologies - for example, if protein-protein interactions show inconsistencies, verify using multiple techniques (pull-down, co-IP, SPR). Sixth, consider strain-specific variations by testing BCE33L0445 from multiple B. cereus strains to determine if observed inconsistencies reflect genuine biological variation. Document all methodological details meticulously to facilitate troubleshooting and ensure reproducibility across different researchers and laboratories .

How might BCE33L0445 contribute to understanding bacterial adaptation to environmental stresses?

BCE33L0445 could serve as a model protein for investigating bacterial stress adaptation mechanisms. Design longitudinal evolution experiments exposing B. cereus to gradually increasing levels of environmental stressors (temperature, pH, antimicrobials) while monitoring BCE33L0445 expression, modification, and mutation patterns. Create reporter strains with the BCE33L0445 promoter fused to fluorescent proteins to monitor real-time expression dynamics during stress transitions. Perform comparative genomic analysis across Bacillus species inhabiting diverse ecological niches to correlate UPF0295 protein sequence variations with environmental adaptations. Investigate whether post-translational modifications of BCE33L0445 (phosphorylation, acetylation) change under different stress conditions using mass spectrometry-based proteomics. Examine potential roles in biofilm formation by comparing wild-type and BCE33L0445 knockout strains' ability to form biofilms under various stress conditions. This research program would establish whether BCE33L0445 functions as a stress response element and how it contributes to bacterial resilience in challenging environments .

What research questions could explore potential interactions between BCE33L0445 and host immune systems?

Future research should investigate potential interactions between BCE33L0445 and host immune systems through several key questions. First, does BCE33L0445 act as a pathogen-associated molecular pattern (PAMP) recognized by specific pattern recognition receptors (PRRs)? Design studies using purified BCE33L0445 to stimulate human immune cells and measure activation of TLR, NOD, or C-type lectin receptor signaling pathways. Second, does BCE33L0445 modulate host immune responses? Compare cytokine production, phagocytosis efficiency, and NET formation in immune cells exposed to wild-type versus BCE33L0445-deficient B. cereus. Third, is BCE33L0445 immunogenic during infection? Analyze serum from patients with B. cereus infections for antibodies against BCE33L0445 using ELISA and Western blotting. Fourth, does BCE33L0445 contribute to immune evasion? Investigate potential mechanisms including complement inhibition, cytokine degradation, or interference with immune signaling pathways. Finally, could BCE33L0445 or derived peptides have immunomodulatory applications? Screen for BCE33L0445-derived peptides with anti-inflammatory or immune-stimulatory properties. These investigations would reveal whether BCE33L0445 plays active roles in host-pathogen interactions .

How can researchers leverage BCE33L0445 studies to advance understanding of uncharacterized bacterial proteomes?

BCE33L0445 research can serve as a model for systematic characterization of uncharacterized bacterial proteins, which constitute a significant portion of bacterial proteomes. Develop an integrated pipeline combining computational prediction (AlphaFold2 structure prediction, protein-protein interaction network analysis) with high-throughput experimental validation (CRISPR interference screens, transposon sequencing) to assign putative functions. Create a standardized phenotypic profiling platform to compare growth characteristics of BCE33L0445 knockout strains across hundreds of conditions using Biolog plates or custom stress arrays. Apply this methodology to other UPF0295 family members and uncharacterized proteins to identify functional patterns. Establish public databases documenting experimental evidence for previously uncharacterized proteins, including negative results. Develop machine learning algorithms trained on successfully characterized proteins to predict functions of remaining uncharacterized proteins. This systematic approach would significantly accelerate the functional annotation of the estimated 30-40% of bacterial proteomes that remain uncharacterized, transforming our understanding of bacterial physiology and identifying new targets for antimicrobial development .