Recombinant Bacillus cereus UPF0295 protein BCQ_0566 (BCQ_0566)

Shipped with Ice Packs
In Stock

Description

Introduction to UPF0295 protein BCQ_0566

Recombinant Bacillus cereus UPF0295 protein BCQ_0566 is a full-length protein originally identified in Bacillus cereus strain Q1 . The protein belongs to the UPF0295 family, where "UPF" designates "Uncharacterized Protein Family," indicating that while the protein has been identified, its precise biological function remains incompletely characterized . The protein is encoded by the BCQ_0566 gene in the Bacillus cereus genome and has been assigned the UniProt identifier B9J3N9 .

The recombinant form of this protein has been successfully expressed in Escherichia coli expression systems, typically with an N-terminal histidine tag to facilitate purification and potential downstream applications . As a recombinant protein, it provides researchers with a tool to study the properties and potential functions of this bacterial protein in controlled experimental settings.

Transmembrane Domain Analysis

Analysis of the amino acid sequence suggests that BCQ_0566 is a transmembrane protein . The hydrophobic stretches within the sequence, particularly in regions containing multiple phenylalanine (F), isoleucine (I), and leucine (L) residues, are characteristic of membrane-spanning domains. The presence of these hydrophobic regions interspersed with charged residues follows patterns typical of integral membrane proteins.

Expression Systems

The recombinant BCQ_0566 protein is primarily expressed in E. coli expression systems, which offer several advantages for protein production including rapid growth, high protein yields, and well-established genetic manipulation techniques . The full-length protein (amino acids 1-118) is typically expressed with an N-terminal histidine tag, most commonly a 10xHis-tag as indicated in some sources .

Purification Protocol

While specific purification protocols may vary between manufacturers, the standard approach for histidine-tagged proteins involves:

  1. Cell lysis to release the expressed protein

  2. Immobilized metal affinity chromatography (IMAC) using nickel or cobalt resins

  3. Elution with increasing concentrations of imidazole

  4. Buffer exchange to remove imidazole and prepare the protein in a suitable storage buffer

The final product typically achieves a purity greater than 90% as determined by SDS-PAGE analysis .

Reconstitution Protocols

For lyophilized preparations, the following reconstitution protocol is recommended:

  1. Briefly centrifuge the vial prior to opening to bring contents to the bottom

  2. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL

  3. Add glycerol to a final concentration of 5-50% (typically 50%) for long-term storage

  4. Prepare aliquots to minimize future freeze-thaw cycles

Shelf Life

The stability of the protein depends on several factors including storage conditions, buffer composition, and the intrinsic stability of the protein itself:

  • Liquid form: Approximately 6 months when stored at -20°C/-80°C

  • Lyophilized form: Approximately 12 months when stored at -20°C/-80°C

Taxonomic Context

BCQ_0566 is derived from Bacillus cereus, a gram-positive, facultatively anaerobic bacterium found in soil and food. B. cereus is known for its role in food poisoning and is closely related to other Bacillus species including the pathogenic B. anthracis and the insecticidal B. thuringiensis .

Protein Family Classification

The protein belongs to the UPF0295 family, a group of uncharacterized proteins that share sequence homology but have not been fully characterized functionally . This classification is part of a broader system used in bioinformatics to group proteins with similar sequences but unknown functions, allowing researchers to make preliminary predictions about potential roles based on conserved domains and structural similarities.

Potential Biological Functions

While the exact function of BCQ_0566 remains to be determined, analysis of its sequence and predicted structure suggests it may function as a membrane protein, potentially involved in:

  • Cell membrane integrity or organization

  • Transport of specific molecules across the membrane

  • Signaling pathways

  • Metal binding or redox activities, suggested by the presence of cysteine residues

Protein-Protein Interaction Studies

The availability of purified recombinant protein enables investigation of potential interaction partners through techniques such as:

  • Co-immunoprecipitation

  • Yeast two-hybrid screening

  • Pull-down assays

  • Surface plasmon resonance

Identifying interaction partners could provide valuable clues to the biological role of this uncharacterized protein .

Antibody Production

Recombinant BCQ_0566 can serve as an antigen for developing specific antibodies, which in turn can be used for:

  • Immunolocalization studies to determine the subcellular location of the native protein

  • Western blotting to detect expression levels in different conditions

  • Immunoprecipitation for protein complex isolation

Functional Characterization

Further research is needed to elucidate the biological function of BCQ_0566, which might include:

  • Gene knockout or knockdown studies in B. cereus to observe phenotypic effects

  • Expression analysis under different growth conditions or stresses

  • Localization studies using fluorescently tagged versions of the protein

  • Metabolomic analyses to identify changes associated with altered expression levels

Potential Biotechnological Applications

If functional studies reveal interesting properties, BCQ_0566 could potentially find applications in:

  • Biosensors, if the protein exhibits specific binding properties

  • Bioremediation, if metal-binding capabilities are confirmed

  • Antimicrobial drug development, if the protein proves essential for bacterial survival

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please consult your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to settle the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on several factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The specific tag type is determined during production. If you require a particular tag, please inform us, and we will prioritize its development.
Synonyms
BCQ_0566; UPF0295 protein BCQ_0566
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-118
Protein Length
full length protein
Species
Bacillus cereus (strain Q1)
Target Names
BCQ_0566
Target Protein Sequence
MSIKYSNKINKIRTFALSLVFIGLFIAYLGVFFRENIIIMTTFMMVGFLAVIASTVVYFW IGMLSTKTVQIICPSCDKPTKMLGRVDACMHCNQPLTMDRNLEGKEFDEKYNKKSYKS
Uniprot No.

Target Background

Database Links

KEGG: bcq:BCQ_0566

Protein Families
UPF0295 family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.