Recombinant Bacillus cereus UPF0316 protein BC_3353 (BC_3353)

What is Bacillus cereus UPF0316 protein BC_3353?

Bacillus cereus UPF0316 protein BC_3353 is a full-length protein (182 amino acids) encoded by the BC_3353 gene in Bacillus cereus strain ATCC 14579 / DSM 31. The protein belongs to the UPF0316 family of proteins with the UniProt accession number Q81B38 . The amino acid sequence begins with "mLQALLIFVLQIIYVPILTIRTILLVKNQTRSAAGVGLLEGAIYIVSLGIVFQDLSNWMN IVAYVIGFSAGLLLGGYIENKLAIGYITYQVSLLDRCNELVDELRHSGFGVTVFEGEGIN SIRYRLDIVAKRSREKELLEIINEIAPKAFMSSYEIRSFKGGYLTKAMKKRALMKKKDEH AS" .

How should recombinant BC_3353 protein be stored for optimal stability?

Recombinant BC_3353 protein should be stored at -20°C in a Tris-based buffer with 50% glycerol that has been optimized for this particular protein. For extended preservation, storage at -80°C is recommended. Working aliquots can be maintained at 4°C for up to one week, but repeated freeze-thaw cycles should be avoided to maintain protein integrity and functionality . For long-term experiments, creating multiple single-use aliquots upon receipt is recommended to prevent degradation from multiple freeze-thaw cycles.

What is the taxonomic context of Bacillus cereus and why is it relevant to BC_3353 research?

Bacillus cereus belongs to the Bacillus cereus sensu lato group, which includes several closely related species such as B. anthracis and B. thuringiensis. The taxonomic relationship is particularly relevant because recent research has identified emerging B. cereus strains that cause anthrax-like diseases through acquisition of virulence plasmids similar to those found in B. anthracis . Understanding the proteins unique to B. cereus, such as BC_3353, helps researchers distinguish between pathogenic and non-pathogenic strains and may provide insights into species-specific functions within this taxonomically complex group.

What are the optimal conditions for expressing recombinant BC_3353 protein in bacterial systems?

For optimal expression of recombinant BC_3353 protein in bacterial systems, consider the following methodological approach:

• Vector selection: Use expression vectors with strong, inducible promoters (e.g., T7 or tac promoters) that are compatible with the host strain.

• Host strain: E. coli BL21(DE3) or similar strains designed for recombinant protein expression are recommended.

• Expression conditions:

  • Initial induction at OD600 of 0.6-0.8

  • IPTG concentration: 0.1-0.5 mM

  • Post-induction temperature: 16-25°C (lower temperatures may increase solubility)

  • Induction time: 4-16 hours (overnight expression at lower temperatures often yields better results)

• Buffer optimization: As BC_3353 is typically stored in Tris-based buffer with 50% glycerol , similar conditions during purification may help maintain stability.

For membrane proteins like BC_3353 (which contains transmembrane regions based on its sequence characteristics), additional considerations include using specific detergents during purification and considering membrane fraction isolation protocols.

What purification strategies are most effective for recombinant BC_3353?

A multi-step purification strategy is recommended for recombinant BC_3353:

Initial Capture:

• Affinity chromatography using the tag determined during production process

  • For His-tagged constructs: Ni-NTA or IMAC columns

  • For GST-tagged constructs: Glutathione Sepharose

  • For MBP-tagged constructs: Amylose resin

Intermediate Purification:

• Ion-exchange chromatography based on the theoretical pI of the protein

• Hydrophobic interaction chromatography if the protein exhibits significant hydrophobic regions

Polishing:

• Size-exclusion chromatography to remove aggregates and ensure homogeneity

Buffer Considerations:

• Maintain Tris-based buffers (pH 7.5-8.0) with glycerol (10-20%) during purification

• Include protease inhibitors in initial extraction steps

• Consider adding stabilizing agents such as NaCl (150-300 mM) throughout

Monitor purity using SDS-PAGE and Western blotting with antibodies specific to the tagged BC_3353 protein at each purification stage.

What analytical methods are recommended for confirming the identity and purity of recombinant BC_3353?

A comprehensive analytical strategy should include:

• SDS-PAGE: To assess purity and approximate molecular weight

• Western Blot: Using antibodies against the tag or against BC_3353 specifically

• Mass Spectrometry:

  • MALDI-TOF for intact mass determination

  • LC-MS/MS for peptide mapping and sequence confirmation

• Size-Exclusion Chromatography: To assess homogeneity and oligomeric state

• Dynamic Light Scattering: To determine size distribution and detect aggregation

• Circular Dichroism: To confirm secondary structure elements

• N-terminal Sequencing: To confirm correct processing of the protein

For transmembrane proteins like BC_3353, additional validation through membrane incorporation assays might be valuable to confirm functional integrity.

What structural and functional predictions can be made about BC_3353 based on sequence homology?

Based on sequence analysis of BC_3353, several structural and functional predictions can be made:

Structural Predictions:

• The amino acid sequence suggests multiple hydrophobic regions characteristic of a transmembrane protein

• The pattern "IVAYVIGFSAGLLLGGYIEN" indicates a potential alpha-helical transmembrane domain

• The relatively conserved C-terminal domain may be involved in protein-protein interactions

Functional Predictions:

• The UPF0316 family designation indicates it belongs to a family of proteins with unknown function

• The presence of multiple transmembrane domains suggests it may function as a transporter or channel

• The conserved sequence "FGVTVFEGEGINSIRYRLD" may represent a functional motif involved in substrate binding or catalysis

Experimental Approaches to Test Predictions:

• Site-directed mutagenesis of conserved residues

• Subcellular localization studies using fluorescently tagged constructs

• Protein-protein interaction studies using pull-down assays or yeast two-hybrid systems

• Heterologous expression in model organisms lacking homologous proteins to observe phenotypic effects

How does BC_3353 relate to virulence in B. cereus strains capable of causing anthrax-like disease?

While the specific role of BC_3353 in virulence has not been directly established in the provided literature, researchers can explore this relationship through several approaches:

• Comparative Genomics Analysis:

  • Compare presence/absence and sequence variation of BC_3353 between pathogenic and non-pathogenic B. cereus strains

  • Analyze BC_3353 expression in atypical B. cereus strains that cause anthrax-like disease versus typical B. cereus

  • Evaluate genomic context to determine if BC_3353 is associated with known virulence regions

• Experimental Verification:

  • Create BC_3353 knockout mutants and assess changes in virulence in appropriate models

  • Perform complementation studies to confirm phenotypic observations

  • Conduct gene expression analysis during infection to determine if BC_3353 is differentially regulated

• Protein Interaction Studies:

  • Identify BC_3353 binding partners, particularly among known virulence factors

  • Investigate potential interactions with plasmid-encoded factors on pBCXO1 or pBCXO2, which are associated with anthrax-like disease capabilities

It's worth noting that B. cereus strains capable of causing anthrax-like disease typically harbor plasmids similar to the pXO1 and pXO2 plasmids found in B. anthracis, encoding toxin components and capsule biosynthesis genes, respectively . BC_3353, being chromosomally encoded, may play an indirect role in virulence through regulatory mechanisms or by facilitating adaptation to host environments.

What approaches are recommended for studying protein-protein interactions involving BC_3353?

For studying protein-protein interactions involving BC_3353, a multi-technique approach is recommended:

In Vitro Methods:

• Pull-down Assays: Using tagged recombinant BC_3353 as bait to capture interaction partners from B. cereus lysates

• Surface Plasmon Resonance (SPR): For kinetic analysis of specific interactions

• Isothermal Titration Calorimetry (ITC): To determine binding thermodynamics

• Cross-linking Mass Spectrometry: To identify interaction interfaces

In Vivo Methods:

• Bacterial Two-Hybrid System: Adapted for membrane proteins

• Co-immunoprecipitation: Using antibodies against BC_3353 or potential partners

• Proximity Labeling: Using BioID or APEX2 fusions to identify proximal proteins

• Fluorescence Microscopy: FRET or BiFC to visualize interactions in living cells

Computational Methods:

• Protein-Protein Interaction Prediction: Using algorithms that account for membrane protein characteristics

• Molecular Docking: To model potential interaction interfaces

• Coevolution Analysis: To identify potentially interacting residues

When designing these experiments, consider the membrane-associated nature of BC_3353 and employ detergents compatible with maintaining protein structure and interactions. Validation across multiple techniques is essential due to the challenging nature of membrane protein interaction studies.

What is the optimal experimental design for investigating BC_3353 function in B. cereus?

A comprehensive experimental design to investigate BC_3353 function should incorporate multiple approaches:

Genetic Approaches:

• Gene Deletion: Create a clean deletion mutant of BC_3353 using allelic exchange

• Complementation: Reintroduce BC_3353 under its native promoter on a plasmid

• Conditional Expression: Use inducible systems to modulate BC_3353 expression levels

• Reporter Fusions: Create transcriptional and translational fusions to monitor expression patterns

Phenotypic Characterization:

• Growth Curves: Compare mutant and wild-type growth under various conditions (temperature, pH, osmolarity)

• Stress Response: Challenge with antibiotics, oxidative stress, membrane stressors

• Morphological Analysis: Microscopy to assess cell shape, membrane integrity, division

• Virulence Models: If appropriate, test in cell culture or animal models

Biochemical Approaches:

• Membrane Fraction Analysis: Assess impact on membrane composition

• Metabolomic Profiling: Identify metabolic changes in mutant strains

• Transport Assays: If suspected to be a transporter, test substrate specificity

Control Considerations:

• Include isogenic parent strain as positive control

• Create deletion mutants of unrelated genes as specificity controls

• Complement with both wild-type and site-directed mutant versions of BC_3353

• Test multiple independent mutant clones to rule out secondary mutations

How can researchers design effective controls when studying BC_3353 in the context of B. cereus pathogenicity?

When studying BC_3353 in pathogenicity contexts, implement the following control strategies:

Genetic Controls:

• Parent Strain Control: Always include the unmodified parent strain

• Empty Vector Control: For complementation studies

• Heterologous Expression Control: Express BC_3353 in a non-pathogenic surrogate like B. subtilis

• Multiple Mutant Lines: Create and test several independent BC_3353 mutants

Pathogenicity Model Controls:

• Known Virulence Factor Mutants: Include strains with deletions in established virulence genes

• Avirulent Reference Strains: Include lab-adapted strains with attenuated virulence

• Dose-Response Controls: Test multiple bacterial doses to establish threshold effects

• Time-Course Analysis: Sample at multiple time points to capture dynamic effects

Sample Processing Controls:

• Spiked Samples: Add known quantities of purified protein to establish recovery rates

• Technical Replicates: Process samples in duplicate or triplicate

• Blinded Analysis: Have analysts unaware of sample identity perform critical measurements

Statistical Design Considerations:

• Power Analysis: Ensure sufficient sample size to detect meaningful differences

• Randomization: Random assignment of animals or cell cultures to treatment groups

• Blocking: Control for known confounding variables

• Appropriate Statistical Tests: Select tests based on data distribution and experimental design

These controls help ensure that observed effects are specifically attributable to BC_3353 and not to experimental artifacts or confounding variables .

What proteomics approaches are most suitable for studying BC_3353 in the context of the B. cereus membrane proteome?

For studying BC_3353 within the B. cereus membrane proteome, specialized proteomics approaches should be employed:

Sample Preparation Strategies:

• Membrane Enrichment:

  • Differential centrifugation

  • Density gradient separation

  • Two-phase partitioning systems

• Protein Solubilization:

  • Detergent screening (mild non-ionic detergents like DDM or CHAPS)

  • Lipid nanodiscs for maintaining native environment

  • Membrane-active agents like methanol for precipitation protocols

Analytical Techniques:

• Gel-Based Approaches:

  • Blue native PAGE for protein complexes

  • 2D-PAGE with specialized first dimension for membrane proteins

• MS-Based Approaches:

  • Data-independent acquisition (DIA) for comprehensive membrane proteome coverage

  • Targeted proteomics (PRM or MRM) for quantitative analysis of BC_3353 and interacting partners

  • Cross-linking MS to identify spatial relationships within membrane complexes

• Label-Based Quantification:

  • SILAC or TMT labeling for comparative analysis

  • Label-free quantification with appropriate normalization for membrane proteins

Data Analysis Considerations:

• Specialized search parameters for transmembrane peptides

• Hydrophobicity-aware peptide detection algorithms

• Topology prediction integration into peptide identification

This comprehensive membrane proteomics workflow will provide insights into BC_3353's abundance, localization, post-translational modifications, and protein-protein interactions within the native B. cereus membrane environment.

What computational tools and approaches can be used to predict the function of BC_3353?

A multi-layered computational strategy is recommended for predicting BC_3353 function:

Sequence-Based Analysis:

• Homology Detection:

  • PSI-BLAST and HHpred for distant homolog identification

  • HMMER for profile-based searches

• Domain and Motif Analysis:

  • InterProScan for functional domain identification

  • MEME for de novo motif discovery

• Evolutionary Analysis:

  • ConSurf for conservation mapping

  • Evolutionary trace methods to identify functionally important residues

Structural Prediction:

• Topology Prediction:

  • TMHMM and TOPCONS for transmembrane helices

  • Signal peptide prediction using SignalP

• 3D Structure Prediction:

  • AlphaFold2 or RoseTTAFold for tertiary structure

  • Molecular dynamics simulations to refine membrane protein models

Systems Biology Approaches:

• Gene Neighborhood Analysis:

  • Examine genomic context across multiple species

  • Identify conserved operons or gene clusters

• Co-expression Network Analysis:

  • Utilize available transcriptomic data to identify co-regulated genes

• Phylogenetic Profiling:

  • Correlate presence/absence patterns across species

Integrated Function Prediction:

• MetaGO or COFACTOR tools that integrate multiple sources of evidence

• Protein-protein interaction predictions using STRING database

• Molecular docking with potential substrates or interacting proteins

The results from these computational analyses should guide experimental design for functional validation, particularly focusing on predicted binding sites, catalytic residues, or protein interaction interfaces.

How does BC_3353 research contribute to our understanding of B. cereus evolution and adaptation?

Studying BC_3353 can provide valuable insights into B. cereus evolution and adaptation through several research avenues:

Evolutionary Analysis:

• Phylogenetic Distribution: Analyzing the presence/absence and sequence conservation of BC_3353 across B. cereus sensu lato group can reveal evolutionary patterns

• Selection Pressure Analysis: Calculating dN/dS ratios to determine if BC_3353 is under purifying, neutral, or positive selection

• Horizontal Gene Transfer Assessment: Examining GC content, codon usage, and genomic context to identify potential horizontal acquisition events

Adaptation Mechanisms:

• Expression Studies: Analyzing BC_3353 expression under different environmental conditions can reveal its role in adaptive responses

• Stress Response Connection: Determining if BC_3353 is regulated by stress response pathways specific to B. cereus lifestyle

• Host Interaction Studies: Investigating expression changes during host colonization or infection

Comparative Analysis with Related Species:

• Function Divergence: Comparing BC_3353 with homologs in B. anthracis and B. thuringiensis to identify species-specific adaptations

• Niche Specialization: Correlating BC_3353 variants with ecological niches occupied by different B. cereus strains

• Virulence Correlation: Examining potential associations between BC_3353 variants and the spectrum of virulence observed in B. cereus strains

This research contributes to the broader understanding of how chromosomal genes like BC_3353 interact with acquired virulence factors (such as those on pBCXO1 and pBCXO2 plasmids) to enable the emergence of novel pathogenic variants within the B. cereus group .

What methodological approaches are recommended for studying BC_3353 expression under different environmental conditions?

A comprehensive methodology for studying BC_3353 expression under varying environmental conditions should include:

Transcriptional Analysis:

Translational/Protein Level Analysis:

Experimental Design Considerations:

• Environmental Variables to Test:

  • Growth phase dependencies (lag, log, stationary)

  • Temperature ranges (psychrophilic to thermophilic conditions)

  • pH variations (acidic to alkaline)

  • Oxygen availability (aerobic, microaerobic, anaerobic)

  • Nutrient limitations (carbon, nitrogen, phosphorus)

  • Host-relevant conditions (serum exposure, macrophage interaction)

  • Stress conditions (osmotic, oxidative, antimicrobial)

• Temporal Considerations:

  • Immediate responses (0-30 minutes)

  • Short-term adaptation (1-4 hours)

  • Long-term adaptation (overnight to several days)

• Control Strategies:

  • Include known condition-responsive control genes

  • Monitor multiple housekeeping genes for normalization

  • Use time-matched controls for all conditions

This methodological framework allows for comprehensive characterization of BC_3353 expression patterns, providing insights into its potential roles in B. cereus environmental adaptation and pathogenicity.

What are the key challenges and opportunities in BC_3353 research?

Current Challenges:

• Limited Functional Characterization: The UPF0316 protein family remains largely uncharacterized functionally

• Membrane Protein Complexity: The apparent transmembrane nature of BC_3353 presents technical difficulties for structural and functional studies

• Species Context Specificity: Understanding how BC_3353 functions specifically in B. cereus versus related species requires careful comparative studies

• Connecting to Virulence: Establishing relationships between chromosomal genes like BC_3353 and plasmid-borne virulence factors in pathogenic B. cereus strains

Research Opportunities:

• Structural Biology Advances: Emerging techniques for membrane protein structure determination (cryo-EM, improved crystallization methods) could reveal BC_3353 function

• Systems Biology Integration: Incorporating BC_3353 into comprehensive models of B. cereus metabolism and virulence networks

• Single-Cell Technologies: Applying new single-cell techniques to understand BC_3353 expression heterogeneity in bacterial populations

• Synthetic Biology Approaches: Engineering BC_3353 variants to probe structure-function relationships and potential applications

Future Research Priorities:

• Determine three-dimensional structure of BC_3353 and identify functional domains

• Establish definitive phenotypes for BC_3353 knockout mutants under various conditions

• Identify interaction partners and their relationship to known cellular processes

• Investigate potential roles in membrane homeostasis, transport, or signaling

• Explore expression patterns during infection or environmental stress

These challenges and opportunities highlight the potential significance of BC_3353 research in advancing our understanding of B. cereus biology and potentially identifying new targets for antimicrobial development.

How can quasi-experimental designs be optimized for studying BC_3353 function in complex biological systems?

Optimizing quasi-experimental designs for BC_3353 functional studies requires careful consideration of design, execution, and analysis approaches:

Design Phase Optimization:

• Selection of Appropriate QED Type:

  • Pre-post designs with non-equivalent control groups for comparing wild-type and mutant strains

  • Interrupted time series for studying BC_3353 expression dynamics

  • Stepped wedge designs for sequential introduction of BC_3353 variants across experimental groups

• Strengthening Internal Validity:

  • Include multiple control groups (positive, negative, procedural)

  • Ensure balanced design with matched characteristics between test and control groups

  • Incorporate randomization elements where possible

  • Plan for sufficient replication to address biological variability

Execution Phase Strategies:

• Data Collection Optimization:

  • Implement blinded assessment of outcomes

  • Use automated measurement systems to reduce observer bias

  • Collect data at multiple time points to capture dynamic responses

  • Include technical replicates to assess measurement error

• Minimizing Confounding Variables:

  • Standardize experimental conditions and protocols

  • Control for batch effects through appropriate experimental design

  • Monitor and record potential confounding variables for later statistical adjustment

  • Use batch processing of samples when possible

Analysis Phase Approaches:

• Statistical Methods for Causal Inference:

  • Difference-in-differences analysis to account for pre-existing group differences

  • Regression adjustment to control for measured confounders

  • Propensity score methods to balance groups on observed characteristics

  • Sensitivity analyses to assess robustness to unmeasured confounding

• Integrated Multi-Omics Analysis:

  • Correlate BC_3353 expression with global transcriptomic, proteomic, and metabolomic changes

  • Apply causal network inference methods to identify direct and indirect effects

  • Use longitudinal data analysis techniques for time-series experiments