Recombinant Bacillus cereus UPF0316 protein BCA_3456 (BCA_3456)

Shipped with Ice Packs
In Stock

Description

General Information

Recombinant Full Length Bacillus cereus UPF0316 protein BCA_3456 (BCA_3456) is a protein that was expressed in E. coli . It is fused to an N-terminal His tag and is a full-length protein consisting of 182 amino acids . Synonyms for this protein include BCA_3456 and UPF0316 protein BCA_3456 .

Table 1: Protein Information

CategoryDescription
Catalog NumberRFL36093BF
SpeciesBacillus cereus
SourceE. coli
TagHis
Protein LengthFull Length (1-182)
FormLyophilized powder
AA SequenceMLQALLIFVLQIIYVPILTIRTILLVKNQTRSAAAVGLLEGAIYIVSLGIVFQDLSNWMNIVAYVIGFSAGLLLGGYIENKLAIGYITYQVSLLDRCNELVDELRHSGFGVTVFEGEGINSIRYRLDIVAKRSREKELLEIINEIAPKAFMSSYEIRSFKGGYLTKAMKKRALMKKKDHHVS
PurityGreater than 90% as determined by SDS-PAGE
StorageStore at -20°C/-80°C upon receipt, aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Storage BufferTris/PBS-based buffer, 6% Trehalose, pH 8.0
ReconstitutionReconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. Adding 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃ is recommended.
Gene NameBCA_3456
SynonymsBCA_3456; UPF0316 protein BCA_3456
UniProt IDC1ELN0

Sequence Information

The protein consists of 182 amino acids . The amino acid sequence is as follows :

MLQALLIFVLQIIYVPILTIRTILLVKNQTRSAAAVGLLEGAIYIVSLGIVFQDLSNWMNIVAYVIGFSAGLLLGGYIENKLAIGYITYQVSLLDRCNELVDELRHSGFGVTVFEGEGINSIRYRLDIVAKRSREKELLEIINEIAPKAFMSSYEIRSFKGGYLTKAMKKRALMKKKDHHVS

Biological Context

Bacillus cereus is a Gram-positive, facultatively anaerobic, spore-forming bacterium commonly found in various environments such as soil, vegetation, and foods . It is known for producing toxins that can cause foodborne illnesses, such as diarrheal and emetic syndromes .

entD Protein

Research has identified entD as a novel exoprotein in B. cereus ATCC 14579 . Disruption of entD significantly impacts glucose catabolism in an oxygen-independent manner, decreasing the B. cereus growth rate and acetate overflow without significantly changing the final biomass . The entD gene, also known as BC_3716, encodes a protein of 316 amino acids with a molecular mass of 33463.9 Da and an isoelectric point of 8.93 . The protein sequence contains two N-terminus SH3_3 domains and a C-terminus cell wall binding domain .

Product Specs

Form
Lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your format preference in your order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs unless dry ice shipping is specifically requested and agreed upon in advance. Additional fees apply for dry ice shipping.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a reference.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer components, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.
If you require a specific tag type, please inform us, and we will prioritize its development.
Synonyms
BCA_3456; UPF0316 protein BCA_3456
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-182
Protein Length
full length protein
Species
Bacillus cereus (strain 03BB102)
Target Names
BCA_3456
Target Protein Sequence
MLQALLIFVLQIIYVPILTIRTILLVKNQTRSAAAVGLLEGAIYIVSLGIVFQDLSNWMN IVAYVIGFSAGLLLGGYIENKLAIGYITYQVSLLDRCNELVDELRHSGFGVTVFEGEGIN SIRYRLDIVAKRSREKELLEIINEIAPKAFMSSYEIRSFKGGYLTKAMKKRALMKKKDHH VS
Uniprot No.

Target Background

Database Links

KEGG: bcx:BCA_3456

Protein Families
UPF0316 family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is Recombinant Bacillus cereus UPF0316 protein BCA_3456 and what are its basic characteristics?

Recombinant Bacillus cereus UPF0316 protein BCA_3456 is a full-length protein (amino acids 1-182) derived from Bacillus cereus strain 03BB102. According to database information, it has UniProt ID C1ELN0 and belongs to the uncharacterized protein family UPF0316 . The protein is typically expressed recombinantly with an N-terminal His tag in E. coli expression systems .

Key characteristics include:

  • Protein length: 182 amino acids

  • Molecular weight: Approximately 20 kDa

  • Hydrophobic profile: Contains multiple hydrophobic regions suggesting membrane association

  • Source organism: Bacillus cereus, a Gram-positive, facultative aerobic, spore-forming bacterium commonly found in soil and food products

How is Bacillus cereus classified in laboratory settings and what precautions should be taken?

Bacillus cereus is classified as:

  • Risk Group 2 (RG-2) organism

  • Requires Biosafety Level 2 (BSL-2) laboratory conditions

  • Animal Housing Biosafety Level 2 (ABSL-2) for animal studies

Agent TypeRisk GroupBiosafety LevelAnimal Housing Biosafety Level
BacteriaRG-2BSL-2ABSL-2

Precautions include:

  • Standard BSL-2 practices and personal protective equipment

  • Work within biological safety cabinets when handling cultures

  • Proper decontamination of all materials used with the organism

  • Consideration of B. cereus's ability to form heat-resistant spores when developing sterilization protocols

What methods are recommended for the expression and purification of recombinant BCA_3456?

Based on established protocols for similar recombinant proteins, researchers should consider:

Expression system selection:

  • E. coli is the most common host for BCA_3456 expression

  • Selection of appropriate E. coli strains (BL21(DE3), Rosetta, or C41/C43 for potentially toxic membrane proteins)

  • Consideration of codon optimization if expression yields are low

Expression optimization:

  • Testing various induction conditions (IPTG concentration, temperature, duration)

  • Growth media optimization (rich media vs. minimal media)

  • Co-expression with chaperones if folding appears problematic

Purification strategy:

  • Affinity chromatography using Ni-NTA resin for His-tagged protein

  • Size exclusion chromatography for further purification

  • Ion exchange chromatography if additional purity is required

When purifying membrane-associated proteins like BCA_3456, incorporation of appropriate detergents during membrane solubilization is critical to maintain native conformation .

What are common bottlenecks in recombinant protein expression and how can they be addressed for BCA_3456?

According to research on expression bottlenecks, several challenges may arise when working with recombinant proteins like BCA_3456:

Potential bottlenecks and solutions:

BottleneckPotential Solutions
Protein aggregationLower expression temperature (16-20°C); co-express with chaperones
Low protein yieldOptimize codon usage; test different promoters; use specialized expression strains
Improper foldingAdd folding enhancers; optimize redox environment; use periplasmic expression
Protein toxicity to hostUse tightly regulated expression systems; reduce induction strength
Inclusion body formationReduce expression rate; add solubility tags; develop refolding protocols

Research by scientists studying recombinant antibody production found that "heavy chains were misassembled and accumulated to form intracellular aggregates" despite the presence of their binding partners . This suggests that monitoring protein assembly during expression and implementing strategies to enhance proper folding could be critical for successful BCA_3456 expression.

What bioinformatic approaches can help predict the function of uncharacterized proteins like BCA_3456?

For uncharacterized proteins like BCA_3456, a multi-tiered bioinformatic approach is recommended:

  • Sequence-based analyses:

    • BLAST searches against characterized proteins

    • Motif scanning using PROSITE, PFAM, and InterPro

    • Transmembrane topology prediction using TMHMM or Phobius

    • Signal peptide prediction using SignalP

  • Structure prediction:

    • Secondary structure prediction using PSIPRED or JPred

    • 3D structure modeling using I-TASSER, AlphaFold, or TrRosetta

    • Model validation using ERRAT and VERIFY3D

    • Structure-based function prediction using COACH server

  • Genomic context analysis:

    • Examination of neighboring genes and operons

    • Comparative genomics across different Bacillus species

    • Phylogenetic profiling to identify co-evolving proteins

Similar approaches have been successfully used in studies of other Bacillus proteins to predict function and guide experimental design .

What are the optimal storage and handling conditions for recombinant BCA_3456?

Based on technical specifications, the following conditions are recommended:

Storage recommendations:

  • Store lyophilized protein at -20°C/-80°C upon receipt

  • For reconstituted protein, store at -20°C/-80°C with 50% glycerol

  • Working aliquots may be stored at 4°C for up to one week

  • Avoid repeated freeze-thaw cycles as they can lead to protein degradation and loss of activity

Reconstitution protocol:

  • Briefly centrifuge the vial prior to opening to bring contents to the bottom

  • Reconstitute in deionized sterile water to a concentration of 0.1-1.0 mg/mL

  • Add glycerol to a final concentration of 5-50% (50% is recommended)

  • Aliquot for long-term storage

Buffer composition:

  • Standard storage buffer: Tris/PBS-based buffer with 6% Trehalose, pH 8.0

  • For membrane proteins like BCA_3456, consider addition of stabilizing agents or detergents if activity is compromised

What experimental design approaches are appropriate for studying the function of BCA_3456?

A comprehensive approach to studying proteins of unknown function like BCA_3456 should include:

Localization studies:

  • Fluorescent protein tagging or immunofluorescence to determine cellular localization

  • Cell fractionation and Western blotting to confirm membrane association

  • Topology mapping using protease accessibility assays

Interaction studies:

  • Pull-down assays using His-tagged BCA_3456 as bait

  • Bacterial two-hybrid systems to identify potential protein partners

  • Crosslinking studies to capture transient interactions

Functional characterization:

  • Gene deletion/complementation studies in Bacillus cereus

  • Phenotypic analysis of deletion mutants under various stress conditions

  • Heterologous expression and functional testing in model systems

Structural studies:

  • Circular dichroism spectroscopy for secondary structure analysis

  • Limited proteolysis to identify folded domains

  • X-ray crystallography or cryo-EM for high-resolution structure determination (if sufficient quantities can be purified)

The experimental design should follow established methodological frameworks as described in research methodology resources .

How can researchers validate the purity and integrity of recombinant BCA_3456?

Quality control measures should include:

Purity assessment:

  • SDS-PAGE with Coomassie staining (expected purity >90%)

  • Western blotting using anti-His antibodies for identity confirmation

  • Mass spectrometry to verify molecular weight and sequence coverage

  • Size exclusion chromatography to assess aggregation state

Functional integrity:

  • Circular dichroism spectroscopy to confirm proper secondary structure

  • Thermal shift assays to evaluate protein stability

  • Activity assays (once function is determined)

Contaminant testing:

  • Endotoxin testing if the protein will be used in cell culture experiments

  • Host cell protein analysis using sensitive detection methods

  • DNA contamination assessment, particularly if used for structural studies

What are the considerations for designing site-directed mutagenesis studies for BCA_3456?

When designing mutagenesis studies for BCA_3456, researchers should consider:

Target selection:

  • Conserved residues identified through multiple sequence alignments of UPF0316 family proteins

  • Charged residues that may participate in molecular interactions

  • Hydrophobic residues in predicted transmembrane regions

  • The positively charged C-terminal region (RALMKKKDHHVS)

Mutation types:

  • Conservative substitutions to maintain structural integrity

  • Non-conservative substitutions to test functional hypotheses

  • Deletion mutants to assess domain functions

  • Chimeric constructs with related proteins to map functional regions

Control constructs:

  • Wild-type protein expressed under identical conditions

  • Mutations in non-conserved regions as negative controls

  • Established mutations in related proteins as positive controls

Evaluation methods:

  • Expression and folding assessment for each mutant

  • Localization studies to ensure proper targeting

  • Functional assays based on predicted roles

  • Interaction studies to map binding interfaces

How does BCA_3456 compare to other proteins in the UPF0316 family across different bacterial species?

Comparative analysis of UPF0316 family proteins reveals:

  • Conservation pattern: Highly conserved in Bacillus species with varying degrees of similarity in other bacterial genera

  • Genomic context: Often found in similar operons across related species, suggesting functional conservation

  • Domain architecture: Consistent pattern of hydrophobic regions indicating membrane association across the family

Such comparative approaches have been successfully employed in studies characterizing other uncharacterized proteins. For example, researchers investigating mercury detoxification in Bacillus cereus used comparative genomics to identify and characterize the role of genes in remediation processes .

What techniques are most appropriate for investigating potential roles of BCA_3456 in Bacillus cereus pathogenesis?

For investigating potential roles in pathogenesis, consider:

In vitro approaches:

  • Adhesion and invasion assays using relevant cell lines

  • Co-culture with immune cells to assess inflammatory responses

  • Growth under conditions mimicking the host environment (pH, temperature, nutrient limitation)

In vivo approaches:

  • Development of BCA_3456 deletion and complementation strains

  • Animal infection models to assess virulence

  • Tissue colonization and persistence studies

Comparative studies:

  • Analysis of BCA_3456 expression levels in virulent vs. non-virulent strains

  • Comparison of expression during different growth phases and stress conditions

  • Examination of gene expression during infection using RNA-seq

Research on Bacillus cereus pathogenesis has established methods for studying virulence factors, including culture on selective media like Bacara or MYP agar, biochemical testing, and molecular characterization approaches .

How can researchers optimize quantitative research methodologies when working with BCA_3456?

When designing quantitative studies involving BCA_3456, consider:

Experimental design principles:

  • Clearly defined variables and controls

  • Sufficient replication to ensure statistical power

  • Randomization and blinding where appropriate

  • Validation using multiple complementary techniques

Data collection considerations:

  • Standardized protocols for consistent results

  • Calibration standards for quantitative measurements

  • Documentation of all experimental conditions and deviations

  • Use of appropriate positive and negative controls

Analysis approaches:

  • Selection of appropriate statistical tests based on data distribution

  • Multiple hypothesis correction for high-throughput studies

  • Consideration of biological vs. technical replication

  • Transparent reporting of all data analysis steps

As noted in methodology resources, "Every discipline uses different methods for research," and researchers should select the approach that best addresses their specific research question .

What are the common challenges in functional characterization of membrane proteins like BCA_3456 and how can they be addressed?

Membrane proteins present unique challenges that require specialized approaches:

Challenges and solutions:

ChallengeSolution Approach
Maintaining native conformationUse mild detergents; consider nanodiscs or liposomes for reconstitution
Low expression yieldsOptimize expression constructs; use specialized membrane protein expression systems
Difficult crystallizationConsider LCP crystallization; explore cryo-EM as alternative
Assessing proper foldingDevelop ligand binding assays; use conformation-specific antibodies
Functional reconstitutionEstablish proteoliposome systems; develop in vitro transport assays

Researchers studying recombinant protein expression have noted that "the primary amino acid sequence and consequently the resulting structure of an expressed protein need to be considered as a factor influencing a cell's productivity" . This is particularly relevant for membrane proteins like BCA_3456.

How can researchers integrate qualitative and quantitative methods when studying BCA_3456?

An integrated approach combining qualitative and quantitative methods offers comprehensive insights:

Qualitative approaches:

  • Detailed observation of phenotypic changes in deletion mutants

  • Exploration of protein localization patterns

  • Analysis of structural features and conformational states

Quantitative approaches:

  • Precise measurement of binding affinities

  • Quantification of expression levels under different conditions

  • Statistical analysis of phenotypic effects

Integration strategies:

  • Sequential design: Use qualitative findings to inform quantitative experiments

  • Parallel design: Conduct qualitative and quantitative studies simultaneously

  • Conversion design: Transform qualitative observations into quantifiable metrics

As described in methodology resources, "Quantitative research involves collecting numerical data and conducting mathematical analyses to observe trends, make predictions, run experiments, and test hypotheses," while qualitative research helps understand concepts and experiences . Integrating both approaches provides a more complete understanding of BCA_3456's biological role.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.