Recombinant Full Length Bacillus cereus UPF0316 protein BCA_3456 (BCA_3456) is a protein that was expressed in E. coli . It is fused to an N-terminal His tag and is a full-length protein consisting of 182 amino acids . Synonyms for this protein include BCA_3456 and UPF0316 protein BCA_3456 .
| Category | Description |
|---|---|
| Catalog Number | RFL36093BF |
| Species | Bacillus cereus |
| Source | E. coli |
| Tag | His |
| Protein Length | Full Length (1-182) |
| Form | Lyophilized powder |
| AA Sequence | MLQALLIFVLQIIYVPILTIRTILLVKNQTRSAAAVGLLEGAIYIVSLGIVFQDLSNWMNIVAYVIGFSAGLLLGGYIENKLAIGYITYQVSLLDRCNELVDELRHSGFGVTVFEGEGINSIRYRLDIVAKRSREKELLEIINEIAPKAFMSSYEIRSFKGGYLTKAMKKRALMKKKDHHVS |
| Purity | Greater than 90% as determined by SDS-PAGE |
| Storage | Store at -20°C/-80°C upon receipt, aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles. |
| Storage Buffer | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
| Reconstitution | Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. Adding 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃ is recommended. |
| Gene Name | BCA_3456 |
| Synonyms | BCA_3456; UPF0316 protein BCA_3456 |
| UniProt ID | C1ELN0 |
The protein consists of 182 amino acids . The amino acid sequence is as follows :
MLQALLIFVLQIIYVPILTIRTILLVKNQTRSAAAVGLLEGAIYIVSLGIVFQDLSNWMNIVAYVIGFSAGLLLGGYIENKLAIGYITYQVSLLDRCNELVDELRHSGFGVTVFEGEGINSIRYRLDIVAKRSREKELLEIINEIAPKAFMSSYEIRSFKGGYLTKAMKKRALMKKKDHHVS
Bacillus cereus is a Gram-positive, facultatively anaerobic, spore-forming bacterium commonly found in various environments such as soil, vegetation, and foods . It is known for producing toxins that can cause foodborne illnesses, such as diarrheal and emetic syndromes .
Research has identified entD as a novel exoprotein in B. cereus ATCC 14579 . Disruption of entD significantly impacts glucose catabolism in an oxygen-independent manner, decreasing the B. cereus growth rate and acetate overflow without significantly changing the final biomass . The entD gene, also known as BC_3716, encodes a protein of 316 amino acids with a molecular mass of 33463.9 Da and an isoelectric point of 8.93 . The protein sequence contains two N-terminus SH3_3 domains and a C-terminus cell wall binding domain .
KEGG: bcx:BCA_3456
Recombinant Bacillus cereus UPF0316 protein BCA_3456 is a full-length protein (amino acids 1-182) derived from Bacillus cereus strain 03BB102. According to database information, it has UniProt ID C1ELN0 and belongs to the uncharacterized protein family UPF0316 . The protein is typically expressed recombinantly with an N-terminal His tag in E. coli expression systems .
Key characteristics include:
Protein length: 182 amino acids
Molecular weight: Approximately 20 kDa
Hydrophobic profile: Contains multiple hydrophobic regions suggesting membrane association
Source organism: Bacillus cereus, a Gram-positive, facultative aerobic, spore-forming bacterium commonly found in soil and food products
Bacillus cereus is classified as:
Risk Group 2 (RG-2) organism
Requires Biosafety Level 2 (BSL-2) laboratory conditions
Animal Housing Biosafety Level 2 (ABSL-2) for animal studies
| Agent Type | Risk Group | Biosafety Level | Animal Housing Biosafety Level |
|---|---|---|---|
| Bacteria | RG-2 | BSL-2 | ABSL-2 |
Precautions include:
Standard BSL-2 practices and personal protective equipment
Work within biological safety cabinets when handling cultures
Proper decontamination of all materials used with the organism
Consideration of B. cereus's ability to form heat-resistant spores when developing sterilization protocols
Based on established protocols for similar recombinant proteins, researchers should consider:
Expression system selection:
Selection of appropriate E. coli strains (BL21(DE3), Rosetta, or C41/C43 for potentially toxic membrane proteins)
Consideration of codon optimization if expression yields are low
Expression optimization:
Testing various induction conditions (IPTG concentration, temperature, duration)
Growth media optimization (rich media vs. minimal media)
Co-expression with chaperones if folding appears problematic
Purification strategy:
Affinity chromatography using Ni-NTA resin for His-tagged protein
Size exclusion chromatography for further purification
Ion exchange chromatography if additional purity is required
When purifying membrane-associated proteins like BCA_3456, incorporation of appropriate detergents during membrane solubilization is critical to maintain native conformation .
According to research on expression bottlenecks, several challenges may arise when working with recombinant proteins like BCA_3456:
Potential bottlenecks and solutions:
| Bottleneck | Potential Solutions |
|---|---|
| Protein aggregation | Lower expression temperature (16-20°C); co-express with chaperones |
| Low protein yield | Optimize codon usage; test different promoters; use specialized expression strains |
| Improper folding | Add folding enhancers; optimize redox environment; use periplasmic expression |
| Protein toxicity to host | Use tightly regulated expression systems; reduce induction strength |
| Inclusion body formation | Reduce expression rate; add solubility tags; develop refolding protocols |
Research by scientists studying recombinant antibody production found that "heavy chains were misassembled and accumulated to form intracellular aggregates" despite the presence of their binding partners . This suggests that monitoring protein assembly during expression and implementing strategies to enhance proper folding could be critical for successful BCA_3456 expression.
For uncharacterized proteins like BCA_3456, a multi-tiered bioinformatic approach is recommended:
Sequence-based analyses:
BLAST searches against characterized proteins
Motif scanning using PROSITE, PFAM, and InterPro
Transmembrane topology prediction using TMHMM or Phobius
Signal peptide prediction using SignalP
Structure prediction:
Secondary structure prediction using PSIPRED or JPred
3D structure modeling using I-TASSER, AlphaFold, or TrRosetta
Model validation using ERRAT and VERIFY3D
Structure-based function prediction using COACH server
Genomic context analysis:
Examination of neighboring genes and operons
Comparative genomics across different Bacillus species
Phylogenetic profiling to identify co-evolving proteins
Similar approaches have been successfully used in studies of other Bacillus proteins to predict function and guide experimental design .
Based on technical specifications, the following conditions are recommended:
Storage recommendations:
Store lyophilized protein at -20°C/-80°C upon receipt
For reconstituted protein, store at -20°C/-80°C with 50% glycerol
Working aliquots may be stored at 4°C for up to one week
Avoid repeated freeze-thaw cycles as they can lead to protein degradation and loss of activity
Reconstitution protocol:
Briefly centrifuge the vial prior to opening to bring contents to the bottom
Reconstitute in deionized sterile water to a concentration of 0.1-1.0 mg/mL
Add glycerol to a final concentration of 5-50% (50% is recommended)
Buffer composition:
Standard storage buffer: Tris/PBS-based buffer with 6% Trehalose, pH 8.0
For membrane proteins like BCA_3456, consider addition of stabilizing agents or detergents if activity is compromised
A comprehensive approach to studying proteins of unknown function like BCA_3456 should include:
Localization studies:
Fluorescent protein tagging or immunofluorescence to determine cellular localization
Cell fractionation and Western blotting to confirm membrane association
Topology mapping using protease accessibility assays
Interaction studies:
Pull-down assays using His-tagged BCA_3456 as bait
Bacterial two-hybrid systems to identify potential protein partners
Crosslinking studies to capture transient interactions
Functional characterization:
Gene deletion/complementation studies in Bacillus cereus
Phenotypic analysis of deletion mutants under various stress conditions
Heterologous expression and functional testing in model systems
Structural studies:
Circular dichroism spectroscopy for secondary structure analysis
Limited proteolysis to identify folded domains
X-ray crystallography or cryo-EM for high-resolution structure determination (if sufficient quantities can be purified)
The experimental design should follow established methodological frameworks as described in research methodology resources .
Quality control measures should include:
Purity assessment:
SDS-PAGE with Coomassie staining (expected purity >90%)
Western blotting using anti-His antibodies for identity confirmation
Mass spectrometry to verify molecular weight and sequence coverage
Functional integrity:
Circular dichroism spectroscopy to confirm proper secondary structure
Thermal shift assays to evaluate protein stability
Activity assays (once function is determined)
Contaminant testing:
Endotoxin testing if the protein will be used in cell culture experiments
Host cell protein analysis using sensitive detection methods
DNA contamination assessment, particularly if used for structural studies
When designing mutagenesis studies for BCA_3456, researchers should consider:
Target selection:
Conserved residues identified through multiple sequence alignments of UPF0316 family proteins
Charged residues that may participate in molecular interactions
Hydrophobic residues in predicted transmembrane regions
The positively charged C-terminal region (RALMKKKDHHVS)
Mutation types:
Conservative substitutions to maintain structural integrity
Non-conservative substitutions to test functional hypotheses
Deletion mutants to assess domain functions
Chimeric constructs with related proteins to map functional regions
Control constructs:
Wild-type protein expressed under identical conditions
Mutations in non-conserved regions as negative controls
Established mutations in related proteins as positive controls
Evaluation methods:
Expression and folding assessment for each mutant
Localization studies to ensure proper targeting
Functional assays based on predicted roles
Interaction studies to map binding interfaces
Comparative analysis of UPF0316 family proteins reveals:
Conservation pattern: Highly conserved in Bacillus species with varying degrees of similarity in other bacterial genera
Genomic context: Often found in similar operons across related species, suggesting functional conservation
Domain architecture: Consistent pattern of hydrophobic regions indicating membrane association across the family
Such comparative approaches have been successfully employed in studies characterizing other uncharacterized proteins. For example, researchers investigating mercury detoxification in Bacillus cereus used comparative genomics to identify and characterize the role of genes in remediation processes .
For investigating potential roles in pathogenesis, consider:
In vitro approaches:
Adhesion and invasion assays using relevant cell lines
Co-culture with immune cells to assess inflammatory responses
Growth under conditions mimicking the host environment (pH, temperature, nutrient limitation)
In vivo approaches:
Development of BCA_3456 deletion and complementation strains
Animal infection models to assess virulence
Tissue colonization and persistence studies
Comparative studies:
Analysis of BCA_3456 expression levels in virulent vs. non-virulent strains
Comparison of expression during different growth phases and stress conditions
Examination of gene expression during infection using RNA-seq
Research on Bacillus cereus pathogenesis has established methods for studying virulence factors, including culture on selective media like Bacara or MYP agar, biochemical testing, and molecular characterization approaches .
When designing quantitative studies involving BCA_3456, consider:
Experimental design principles:
Clearly defined variables and controls
Sufficient replication to ensure statistical power
Randomization and blinding where appropriate
Data collection considerations:
Standardized protocols for consistent results
Calibration standards for quantitative measurements
Documentation of all experimental conditions and deviations
Use of appropriate positive and negative controls
Analysis approaches:
Selection of appropriate statistical tests based on data distribution
Multiple hypothesis correction for high-throughput studies
Consideration of biological vs. technical replication
Transparent reporting of all data analysis steps
As noted in methodology resources, "Every discipline uses different methods for research," and researchers should select the approach that best addresses their specific research question .
Membrane proteins present unique challenges that require specialized approaches:
Challenges and solutions:
| Challenge | Solution Approach |
|---|---|
| Maintaining native conformation | Use mild detergents; consider nanodiscs or liposomes for reconstitution |
| Low expression yields | Optimize expression constructs; use specialized membrane protein expression systems |
| Difficult crystallization | Consider LCP crystallization; explore cryo-EM as alternative |
| Assessing proper folding | Develop ligand binding assays; use conformation-specific antibodies |
| Functional reconstitution | Establish proteoliposome systems; develop in vitro transport assays |
Researchers studying recombinant protein expression have noted that "the primary amino acid sequence and consequently the resulting structure of an expressed protein need to be considered as a factor influencing a cell's productivity" . This is particularly relevant for membrane proteins like BCA_3456.
An integrated approach combining qualitative and quantitative methods offers comprehensive insights:
Qualitative approaches:
Detailed observation of phenotypic changes in deletion mutants
Exploration of protein localization patterns
Analysis of structural features and conformational states
Quantitative approaches:
Precise measurement of binding affinities
Quantification of expression levels under different conditions
Statistical analysis of phenotypic effects
Integration strategies:
Sequential design: Use qualitative findings to inform quantitative experiments
Parallel design: Conduct qualitative and quantitative studies simultaneously
Conversion design: Transform qualitative observations into quantifiable metrics
As described in methodology resources, "Quantitative research involves collecting numerical data and conducting mathematical analyses to observe trends, make predictions, run experiments, and test hypotheses," while qualitative research helps understand concepts and experiences . Integrating both approaches provides a more complete understanding of BCA_3456's biological role.