Recombinant Bacillus cereus UPF0316 protein BCAH187_A3394 (BCAH187_A3394)

Shipped with Ice Packs
In Stock

Product Specs

Form
Supplied as a lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in your order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs unless dry ice shipping is specifically requested and pre-arranged. Additional fees apply for dry ice shipping.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard protocol uses 50% glycerol; this can serve as a guideline for your preparation.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot to prevent repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.
The tag type will be determined during production. If you require a specific tag, please inform us, and we will prioritize its inclusion in the production process.
Synonyms
BCAH187_A3394; UPF0316 protein BCAH187_A3394
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-182
Protein Length
full length protein
Species
Bacillus cereus (strain AH187)
Target Names
BCAH187_A3394
Target Protein Sequence
MLQALLIFVLQIIYVPILTIRTILLVKNQTRSAAGVGLLEGAIYIVSLGIVFQDLSNWMN IVAYVIGFSAGLLLGGYIENKLAIGYITYQVSLLDRCNELVDELRHSGFGVTVFEGEGIN SIRYRLDIVAKRSREKELLEIINEIAPKAFMSSYEIRSFKGGYLTKAMKKRALMKKKDHH AS
Uniprot No.

Target Background

Database Links
Protein Families
UPF0316 family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is the basic structural information of the BCAH187_A3394 protein?

The BCAH187_A3394 protein is a UPF0316 family protein from Bacillus cereus strain AH187. The full amino acid sequence consists of 182 amino acids: mLQALLIFVLQIIYVPILTIRTILLVKNQTRSAAGVGLLEGAIYIVSLGIVFQDLSNWMNIVAYVIGFSAGLLLGGYIENKLAIGYITYQVSLLDRCNELVDELRHSGFGVTVFEGEGINSIRYRLDIVAKRSREKELLEIINEIAPKAFMSSYEIRSFKGGYLTKAMKKRALMKKKDHHAS . The protein is cataloged in UniProt under the accession number B7HY28, and the recommended name is UPF0316 protein BCAH187_A3394 .

What are the optimal storage conditions for maintaining BCAH187_A3394 protein stability?

For optimal stability, the recombinant BCAH187_A3394 protein should be stored in a Tris-based buffer with 50% glycerol. The recommended storage temperature is -20°C, while for extended storage periods, conservation at -80°C is advised. It's important to note that repeated freezing and thawing cycles should be avoided as they can lead to protein degradation. For short-term work (up to one week), working aliquots can be maintained at 4°C . Always monitor for signs of aggregation or precipitation when retrieving samples from storage, as these may indicate compromised protein integrity.

How does the membrane topology of BCAH187_A3394 affect its functional properties?

Based on the amino acid sequence analysis, BCAH187_A3394 contains hydrophobic regions (such as LQALLIFVLQIIYVPILTIRTILLVKN) that suggest transmembrane domains . These membrane-associated regions indicate the protein likely functions within the bacterial membrane environment. The topology affects protein-protein interactions, substrate access, and potentially signaling pathways. Researchers should consider using membrane-mimetic environments when studying this protein in vitro. The presence of multiple hydrophobic stretches interspersed with hydrophilic regions suggests a multi-pass transmembrane protein configuration, which has significant implications for experimental design in structural and functional studies.

What expression systems are most effective for producing recombinant BCAH187_A3394?

For efficient expression of recombinant BCAH187_A3394, several host systems can be considered, with selection depending on research objectives. E. coli expression systems provide high yield and simplicity, though proper folding of membrane proteins may be challenging. Based on research with similar Bacillus proteins, cultivation conditions significantly impact expression levels. Recommended media compositions include glucose (1 g/L), peptone (0.5 g/L), KH₂PO₄ (0.1 g/L), K₂HPO₄ (0.3 g/L), MgSO₄ (0.02 g/L), and yeast extract (0.5 g/L) . For membrane proteins like BCAH187_A3394, consider using specialized E. coli strains (such as C41/C43) designed for membrane protein expression. Expression verification can be performed using SDS-PAGE and Western blotting with antibodies against the fusion tag incorporated during cloning.

What purification strategies overcome the challenges associated with BCAH187_A3394's hydrophobic regions?

Purification of BCAH187_A3394 presents challenges due to its hydrophobic regions. A recommended multi-step purification protocol includes:

  • Initial Extraction: Use mild detergents like n-dodecyl-β-D-maltoside (DDM) or lauryl maltose neopentyl glycol (LMNG) to solubilize the protein from membranes without denaturation.

  • Affinity Chromatography: Utilize affinity tags determined during the production process for initial capture. Common options include His-tag with Ni-NTA resin or other fusion partners.

  • Size Exclusion Chromatography: To separate monomeric protein from aggregates and contaminants.

  • Quality Control: Assess protein purity using SDS-PAGE and verify folding using circular dichroism spectroscopy.

Throughout purification, maintain the protein in detergent micelles or nanodiscs to preserve native conformation. The storage buffer should be optimized to contain Tris base with 50% glycerol as used in commercial preparations .

How can isotope labeling be optimized for NMR structural studies of BCAH187_A3394?

For NMR structural studies of BCAH187_A3394, isotope labeling requires careful optimization due to the protein's hydrophobic nature. A methodical approach involves:

  • Expression System Selection: Use E. coli BL21(DE3) or specialized membrane protein expression strains in minimal media.

  • Media Formulation: For ¹⁵N labeling, use M9 minimal media supplemented with ¹⁵NH₄Cl (1 g/L). For ¹³C/¹⁵N double labeling, add ¹³C-glucose (2-4 g/L) as the sole carbon source.

  • Optimization Table:

ParameterStandard ConditionOptimization RangeNotes
Temperature37°C16-30°CLower temperatures often improve folding
IPTG concentration0.5 mM0.1-1.0 mMTitrate to maximize yield/folding ratio
Expression time4 hours4-24 hoursExtended periods at lower temperatures
OD₆₀₀ at induction0.60.4-0.8Balance between cell density and stress response
  • Detergent Selection: For membrane proteins like BCAH187_A3394, detergent micelles compatible with NMR (e.g., DPC, LPPG) or nanodiscs should be used during purification and NMR sample preparation.

  • Sample Preparation: Concentrate to 0.5-1.0 mM in deuterated buffers with appropriate detergents for optimal signal-to-noise ratio.

Monitor sample stability during extended NMR acquisition periods, as membrane proteins may have limited stability in detergent micelles.

What bioinformatic approaches can predict BCAH187_A3394's function given its UPF0316 family classification?

The UPF0316 classification of BCAH187_A3394 indicates it belongs to a family of proteins with unknown function. To predict its potential roles, employ a multi-layered bioinformatic approach:

  • Sequence-Based Analysis:

    • Profile-sequence and profile-profile comparisons using HHpred or HMMER against reference databases

    • Identification of conserved domains and motifs using InterProScan

    • Multiple sequence alignments with other UPF0316 family members to identify conserved residues

  • Structural Prediction:

    • Generate 3D models using AlphaFold2 or RoseTTAFold

    • Compare predicted structures against known protein folds in PDB

    • Analyze surface electrostatics and potential binding sites

  • Genomic Context Analysis:

    • Examine gene neighborhood in Bacillus cereus AH187 for functionally related genes

    • Analyze co-expression patterns across different conditions

    • Identify potential operonic structures that might suggest functional relationships

  • Phylogenetic Analysis:

    • Construct phylogenetic trees of UPF0316 family members

    • Map conserved residues onto the tree to identify evolutionary patterns

    • Compare distribution across different bacterial species

Based on the protein sequence characteristics, particularly the hydrophobic regions, BCAH187_A3394 likely functions as a membrane transport protein or channel . The IYVSIGI and IVAYVIGSAG motifs suggest potential substrate binding regions that can guide experimental design for functional validation.

What experimental approaches can validate the predicted membrane localization of BCAH187_A3394?

To experimentally validate the predicted membrane localization of BCAH187_A3394, researchers should employ complementary techniques:

  • Subcellular Fractionation:

    • Separate bacterial cell fractions (cytoplasmic, membrane, periplasmic) using differential centrifugation

    • Detect protein presence using Western blotting with specific antibodies against BCAH187_A3394 or its fusion tag

    • Include appropriate controls for each fraction (e.g., cytoplasmic and membrane marker proteins)

  • Fluorescence Microscopy:

    • Generate GFP fusion constructs (preferably C-terminal to avoid interfering with signal sequences)

    • Express in Bacillus cereus or heterologous systems

    • Visualize cellular localization using confocal microscopy

    • Counter-stain membranes with specific dyes (e.g., FM4-64)

  • Protease Accessibility Assays:

    • Treat intact cells, spheroplasts, or membrane vesicles with proteases

    • Analyze protection patterns to determine topology

    • Map accessible regions using mass spectrometry

  • Membrane Extraction Analysis:

    • Test extraction efficiency with different detergents or chaotropic agents

    • Compare with known integral membrane and peripheral membrane proteins

    • Analyze extraction patterns under varying ionic strength and pH conditions

These approaches provide complementary evidence for membrane localization and can inform subsequent functional studies by establishing the correct cellular context for protein activity.

How can site-directed mutagenesis of BCAH187_A3394 inform structure-function relationships?

Site-directed mutagenesis provides crucial insights into BCAH187_A3394's structure-function relationships by systematically altering key residues. Based on sequence analysis , several strategic approaches are recommended:

  • Target Selection Strategy:

Residue TypeSelection CriteriaExpected Functional Impact
Conserved hydrophobic (L, I, V)Alignment conservation across UPF0316 familyMembrane integration, protein folding
Charged residues (R, K, E, D)Located in predicted loops or terminiInteraction surfaces, substrate recognition
Aromatic residues (Y, W, F)In predicted binding pocketsSubstrate coordination, stability
Glycine/ProlineIn predicted turns or kinksConformational flexibility, structural transitions
  • Mutation Design Principles:

    • Conservative substitutions (e.g., L→I) to test specific physicochemical properties

    • Charge reversal (e.g., K→E) to probe electrostatic interactions

    • Alanine scanning of predicted functional regions

    • Introduction of reporter groups (e.g., cysteine for fluorescent labeling)

  • Key Regions for Investigation:

    • The IYVPIL sequence (residues 14-19): Likely involved in membrane association

    • The CNELVDELRHSG sequence (residues 102-113): Potential loop region with charged residues

    • The C-terminal KKRALMKKKDH sequence (residues 170-180): Highly charged region suggesting interaction surface

  • Functional Assays Post-Mutagenesis:

    • Membrane integration assays to assess topology changes

    • Thermal stability measurements to evaluate structural integrity

    • Binding assays if substrate candidates are identified

    • In vivo complementation studies using deletion strains

By systematically analyzing mutation effects, researchers can map critical functional elements and begin to unravel the molecular mechanism of this uncharacterized protein.

How can cryo-electron microscopy be optimized for structural determination of BCAH187_A3394?

Cryo-electron microscopy (cryo-EM) offers significant advantages for structural determination of membrane proteins like BCAH187_A3394. To optimize this approach:

  • Sample Preparation Optimization:

    • Express protein with appropriate tags that can be removed post-purification

    • Purify in mild detergents (DDM, LMNG) that maintain native structure

    • Consider reconstitution into nanodiscs or liposomes to provide native-like membrane environment

    • Achieve protein concentration of 2-5 mg/mL with >95% purity

  • Grid Preparation Parameters:

    • Test multiple grid types (Quantifoil R1.2/1.3, UltrAuFoil)

    • Optimize blotting conditions (3-5 seconds at 4°C and 100% humidity)

    • Apply thin, uniform ice layer through controlled blotting and vitrification

    • Consider adding low concentrations (0.01-0.05%) of detergent to the final sample to improve particle distribution

  • Data Collection Strategy:

    • Collect on high-end microscopes (Titan Krios, Glacios) with K3/K2 or Falcon 4 direct electron detectors

    • Use low-dose conditions (~40-60 e⁻/Ų) with dose fractionation

    • Employ beam-tilt pairs for initial model generation

    • Include energy filter to improve contrast

  • Processing Considerations:

    • Implement motion correction and CTF estimation

    • Perform 2D classification to remove non-optimal particles

    • Use ab initio reconstruction without imposing symmetry initially

    • Apply local refinement on transmembrane regions for improved resolution

Given the relatively small size of BCAH187_A3394 (182 amino acids) , consider approaches like Volta phase plates to enhance contrast or potentially combine with complementary techniques like NMR for dynamic regions.

What mass spectrometry approaches can characterize post-translational modifications of BCAH187_A3394?

To comprehensively characterize potential post-translational modifications (PTMs) of BCAH187_A3394, implement a multi-faceted mass spectrometry (MS) approach:

  • Sample Preparation Strategies:

    • Employ multiple proteases (trypsin, chymotrypsin, AspN) to ensure complete sequence coverage

    • Perform enrichment for specific PTMs (phosphopeptides, glycopeptides) using IMAC or hydrophilic interaction chromatography

    • Compare native protein with recombinant versions to identify host-specific modifications

  • MS Acquisition Methods:

    • Bottom-up proteomics using LC-MS/MS with HCD and ETD fragmentation

    • Top-down proteomics of intact protein to preserve PTM stoichiometry and combinations

    • Middle-down approach using limited proteolysis for analysis of larger peptide fragments

  • Data Analysis Workflow:

    • Search against databases with variable modifications including phosphorylation, acetylation, methylation

    • Use open search algorithms to identify unexpected modifications

    • Apply quantitative approaches to determine occupancy rates at modification sites

    • Implement targeted MRM/PRM methods for sensitive detection of key modified peptides

  • Validation Approaches:

    • Site-directed mutagenesis of identified PTM sites

    • Functional assays comparing wildtype and PTM-site mutants

    • Antibodies against specific PTMs for orthogonal validation

Since BCAH187_A3394 is a bacterial protein, focus particularly on phosphorylation, acetylation, and methylation as these are common bacterial PTMs. The protein's UPF0316 family classification suggests potential regulatory functions that might be modulated through PTMs.

How can hydrogen-deuterium exchange mass spectrometry elucidate dynamic regions of BCAH187_A3394?

Hydrogen-deuterium exchange mass spectrometry (HDX-MS) provides valuable insights into protein dynamics, solvent accessibility, and binding interfaces—particularly useful for membrane proteins like BCAH187_A3394:

  • Experimental Design Considerations:

    • Compare HDX rates in different environments (detergent micelles vs. nanodiscs)

    • Establish deuterium labeling time-course (10 sec to 24 hours) to capture fast and slow exchanging regions

    • Maintain pH 7.0-7.5 and low temperature (0-4°C) during quench steps

    • Include non-deuterated controls and fully deuterated samples as reference points

  • Technical Optimization for Membrane Proteins:

    • Select acid-labile detergents that won't interfere with MS analysis

    • Adjust quench conditions to maintain protein solubility while halting exchange

    • Optimize pepsin digestion efficiency through addition of denaturants compatible with UPLC-MS

    • Implement rapid UPLC separation (5-10 min) to minimize back-exchange

  • Data Analysis Framework:

    • Calculate deuterium uptake for each peptide across all time points

    • Generate heat maps to visualize exchange patterns across protein sequence

    • Map results onto predicted structure (based on sequence ) to identify protected and exposed regions

    • Cluster peptides by exchange behavior to identify cooperative units

  • Interpretation Guidelines:

    • Transmembrane regions typically show lower exchange rates

    • Rapid exchange indicates solvent-exposed, potentially disordered regions

    • Intermediate exchange may indicate secondary structure elements at interfaces

    • Compare exchange profiles with predicted topological domains from sequence analysis

This technique will be particularly informative for identifying flexible loops, potential substrate entry channels, and conformational changes in BCAH187_A3394, providing dynamic information complementary to static structural studies.

What techniques can identify potential interaction partners of BCAH187_A3394 in Bacillus cereus?

To systematically identify interaction partners of BCAH187_A3394 in Bacillus cereus, employ a multi-technique approach:

  • Affinity Purification-Mass Spectrometry (AP-MS):

    • Express BCAH187_A3394 with an affinity tag (His, FLAG, or Strep) in B. cereus

    • Perform crosslinking with reagents like DSP or formaldehyde to capture transient interactions

    • Purify under gentle conditions to maintain protein complexes

    • Identify co-purifying proteins using LC-MS/MS

    • Implement controls (tag-only, unrelated membrane protein) to filter non-specific interactions

  • Bacterial Two-Hybrid (B2H) Screening:

    • Create fusion constructs of BCAH187_A3394 with T18 or T25 domains of adenylate cyclase

    • Screen against B. cereus genomic library fusions

    • Validate positive interactions with pairwise tests

    • Quantify interaction strength using β-galactosidase assays

  • Proximity Labeling Methods:

    • Fuse BCAH187_A3394 with BioID or APEX2

    • Express in B. cereus and induce proximity labeling

    • Purify biotinylated proteins and identify by MS

    • Map interaction space in native cellular context

  • Co-localization Studies:

    • Generate fluorescent protein fusions with BCAH187_A3394

    • Co-express with candidate interaction partners

    • Analyze co-localization using super-resolution microscopy

    • Validate using Förster Resonance Energy Transfer (FRET)

Given BCAH187_A3394's predicted membrane localization , focus particularly on other membrane proteins and components of transport systems. Consider specific growth conditions and stressors that might induce functional interactions.

How does BCAH187_A3394 expression vary under different growth conditions or stressors in Bacillus cereus?

Understanding the expression profile of BCAH187_A3394 under different conditions provides critical insights into its physiological role. A comprehensive approach includes:

  • Transcriptional Analysis:

    • Perform RT-qPCR to measure BCAH187_A3394 transcript levels under various conditions

    • Conduct RNA-Seq for genome-wide expression context

    • Map transcription start sites using 5' RACE to identify regulatory elements

    • Analyze promoter region for binding sites of stress-responsive transcription factors

  • Experimental Conditions Matrix:

Condition CategorySpecific VariablesMeasurement PointsExpected Relevance
Growth PhaseLag, exponential, stationary4 timepoints across growth curveMetabolic adaptation
Nutrient LimitationCarbon, nitrogen, phosphate2h after limitation onsetStress response
Membrane StressDetergents, antimicrobials30min, 2h post-exposureMembrane integrity response
Temperature15°C, 30°C, 37°C, 42°CMid-log phaseAdaptation to environmental conditions
Oxidative StressH₂O₂, paraquat15min, 1h post-exposureResistance mechanisms
pH StresspH 5.0, 7.0, 9.01h after pH shiftHomeostasis maintenance
  • Protein-Level Validation:

    • Develop antibodies against BCAH187_A3394 or use epitope tagging

    • Perform Western blots to quantify protein abundance

    • Assess protein half-life under different conditions using translation inhibitors

    • Consider pulse-chase experiments to measure turnover rates

  • Cellular Localization Changes:

    • Monitor potential redistribution using fluorescent protein fusions

    • Perform fractionation studies under different conditions

    • Assess oligomerization state changes using crosslinking or native PAGE

Based on the membrane-associated nature of BCAH187_A3394 , pay particular attention to conditions that affect membrane integrity or composition, such as osmotic stress, membrane-targeting antimicrobials, or temperature shifts that alter membrane fluidity.

What phenotypic changes occur in Bacillus cereus strains with BCAH187_A3394 gene knockout or overexpression?

Phenotypic characterization of BCAH187_A3394 genetic manipulation provides direct evidence of its functional significance. A systematic approach includes:

  • Strain Construction Strategy:

    • Generate clean deletion mutant using homologous recombination or CRISPR-Cas9

    • Create overexpression strain with inducible promoter (e.g., Pspac or PxylA)

    • Develop complementation strain with wild-type gene for validation

    • Include epitope-tagged versions for protein detection

  • Growth and Viability Assessment:

    • Monitor growth curves in different media (rich, minimal, stress conditions)

    • Perform competition assays between mutant and wild-type

    • Assess colony morphology on various agar formulations

    • Determine survival rates following exposure to stressors

  • Membrane-Related Phenotypes:

    • Measure membrane potential using fluorescent dyes (DiBAC4, JC-1)

    • Assess membrane permeability with propidium iodide or SYTOX Green

    • Determine sensitivity to membrane-active compounds

    • Analyze membrane lipid composition using mass spectrometry

  • Physiological Function Tests:

    • Examine biofilm formation capacity

    • Test motility (swimming, swarming)

    • Measure antibiotic susceptibility profiles (particularly effective against B. cereus )

    • Assess virulence in appropriate model systems

  • Molecular Phenotypes:

    • Conduct transcriptome analysis (RNA-Seq) to identify compensatory responses

    • Perform metabolite profiling to detect biochemical changes

    • Investigate protein-protein interaction network alterations

Since BCAH187_A3394 is likely membrane-associated , particular attention should be given to phenotypes related to membrane integrity, transport functions, or signaling pathways that could connect to its UPF0316 family classification.

How can researchers address the solubility challenges when working with the hydrophobic regions of BCAH187_A3394?

Working with the hydrophobic regions of BCAH187_A3394 presents significant solubility challenges that require strategic approaches:

  • Protein Construct Engineering:

    • Create truncation constructs that isolate soluble domains

    • Design fusion proteins with highly soluble partners (MBP, SUMO, Trx)

    • Implement systematic alanine substitutions of selected hydrophobic residues

    • Consider chimeric constructs with homologous proteins that have better expression properties

  • Expression Optimization:

    • Test specialized E. coli strains designed for membrane proteins (C41/C43, Lemo21)

    • Reduce expression temperature (16-25°C) to allow proper folding

    • Use mild induction with low IPTG concentrations (0.1-0.5 mM)

    • Co-express with chaperones (GroEL/ES, DnaK/J) to assist folding

  • Solubilization Strategies:

    • Screen detergent panel (ranging from harsh SDS to mild DDM, LMNG)

    • Test novel amphipathic agents (SMALPs, amphipols, peptidiscs)

    • Implement detergent mixtures that combine solubilization efficiency and structure preservation

    • Consider nanodiscs with different lipid compositions to mimic native environment

  • Stabilization Approaches:

    • Add specific lipids that might interact with the protein

    • Screen stabilizing additives (glycerol, specific salts, osmolytes)

    • Use ligands or inhibitors that bind and stabilize specific conformations

    • Implement protein engineering to introduce stabilizing disulfide bonds

When designing experiments, consider the specific challenges posed by the hydrophobic regions identified in the BCAH187_A3394 sequence , particularly focusing on the predicted transmembrane segments which require special handling to maintain native structure and function.

What are the optimal conditions for studying protein-lipid interactions of BCAH187_A3394?

Given BCAH187_A3394's membrane protein characteristics , understanding its protein-lipid interactions is crucial. Optimal experimental approaches include:

  • Reconstitution Systems Selection:

    • Liposomes with controlled lipid composition

    • Nanodiscs with MSP1D1 or larger scaffolds depending on protein size

    • Lipid cubic phases for structural studies

    • Native membrane extracts from B. cereus for physiological relevance

  • Lipid Composition Screening:

Lipid CategoryComponents to TestRationaleAnalytical Method
PhospholipidsPC, PE, PG, CLBasic membrane componentsFlotation assays, DSC
Fatty acid lengthC14-C20Hydrophobic matchingCD spectroscopy, fluorescence
Head group chargeNeutral, negative, positiveElectrostatic interactionsSurface plasmon resonance
Specific lipidsLipid II, PIP2, sphingolipidsFunctional interactionsBinding assays, HDX-MS
  • Biophysical Characterization Methods:

    • Differential scanning calorimetry (DSC) to measure thermodynamic parameters

    • Fluorescence spectroscopy utilizing intrinsic tryptophans or introduced probes

    • Solid-state NMR to analyze protein-lipid contacts at atomic resolution

    • Molecular dynamics simulations to predict favorable interactions

  • Functional Validation Approaches:

    • Activity assays in different lipid environments

    • Competition experiments with specific lipids

    • Mutagenesis of predicted lipid-binding residues

    • Correlation of lipid binding with structural changes

When analyzing results, consider that B. cereus membranes contain primarily phosphatidylethanolamine, phosphatidylglycerol, and cardiolipin, which should be prioritized in initial screening. The protein's hydrophobic regions suggest potential specific interactions with the lipid bilayer that may be critical for function.

What computational approaches can predict functional sites in BCAH187_A3394 despite limited homology to characterized proteins?

Predicting functional sites in BCAH187_A3394 with limited homology requires sophisticated computational approaches:

  • Sequence-Based Prediction Methods:

    • Conservation analysis across UPF0316 family members

    • Identification of evolutionary coupled residues using direct coupling analysis (DCA)

    • Detection of functional motifs using MEME, GLAM2, and similar tools

    • Analysis of physicochemical property patterns along the sequence

  • Structure-Based Approaches:

    • Generate 3D models using AlphaFold2 or RoseTTAFold

    • Identify potential binding pockets using fpocket, SiteMap, or CASTp

    • Calculate electrostatic potential maps to locate charged interaction sites

    • Perform molecular dynamics simulations to identify conformationally flexible regions

  • Integrative Prediction Framework:

MethodData InputExpected OutputValidation Approach
ConSurfMultiple sequence alignmentConservation scores mapped to structureCorrelation with experimental mutational data
FTMapStructural modelBinding hotspots for small moleculesIn vitro binding assays
COACH-DStructural modelLigand binding sites, protein-protein interfacesTargeted mutagenesis, pull-down assays
MEMSAT-SVMAmino acid sequenceTransmembrane topology, orientationExperimental topology mapping
  • Machine Learning Integration:

    • Apply deep learning methods trained on known membrane protein functions

    • Utilize protein language models to identify functionally important regions

    • Implement ensemble approaches combining multiple predictors

    • Analyze predicted protein-protein interaction networks to infer function

  • Validation Design:

    • Prioritize predicted sites for experimental mutagenesis

    • Design assays to test specific functional hypotheses

    • Create chimeric proteins to test domain functions

    • Develop structural biology experiments focused on predicted active sites

Given the transmembrane nature of BCAH187_A3394 , emphasize methods specifically designed for membrane proteins and focus on regions with distinctive patterns of conservation, accessibility, and physicochemical properties that might indicate substrate binding or transport functions.

How does BCAH187_A3394 compare structurally and functionally with other UPF0316 family proteins?

Comparative analysis of BCAH187_A3394 with other UPF0316 family members provides context for understanding its unique and shared features:

  • Structural Comparison Framework:

    • Generate structural models of multiple UPF0316 family members

    • Perform structural alignments to identify conserved cores and variable regions

    • Analyze conserved surface patches that might indicate functional sites

    • Examine differences in predicted transmembrane topology and orientation

  • Sequence-Structure-Function Relationships:

    • Create multiple sequence alignments of UPF0316 members from diverse bacterial species

    • Map conservation patterns onto structural models

    • Identify co-evolving residue networks that might indicate functional coupling

    • Compare predicted binding sites across family members

  • Taxonomic Distribution Analysis:

    • Examine presence/absence patterns of UPF0316 proteins across bacterial phyla

    • Correlate with ecological niches and metabolic capabilities

    • Identify species-specific adaptations in protein sequence

    • Analyze genomic context for clues about functional relationships

  • Cross-Species Functional Complementation:

    • Test whether BCAH187_A3394 can complement deletion mutants of UPF0316 family members in other bacterial species

    • Analyze whether growth phenotypes differ between complemented strains

    • Identify species-specific functional requirements through domain swapping experiments

    • Create phylogenetic profiles to correlate with specific bacterial traits

While detailed functional characterization of UPF0316 proteins is limited, their consistent membrane-associated nature suggests roles in transport, signaling, or membrane organization. The specific sequence features of BCAH187_A3394 may reflect adaptation to the particular membrane composition or physiological needs of Bacillus cereus strain AH187.

What insights can be gained from comparing BCAH187_A3394 with similar proteins in pathogenic versus non-pathogenic Bacillus species?

Comparative analysis between BCAH187_A3394 and its homologs in different Bacillus species offers valuable insights into potential roles in pathogenicity:

  • Ortholog Identification and Analysis:

    • Identify clear orthologs in pathogenic (B. cereus, B. anthracis) and non-pathogenic (B. subtilis) species

    • Perform detailed sequence alignments to identify pathogen-specific variations

    • Calculate selection pressures (dN/dS ratios) to identify adaptively evolving regions

    • Analyze protein domain architecture for lineage-specific modifications

  • Expression Pattern Comparison:

    • Compare expression profiles during infection models or host-mimicking conditions

    • Identify differential regulation in response to host-specific signals

    • Determine co-expression networks in pathogenic versus non-pathogenic contexts

    • Analyze promoter regions for pathogen-specific regulatory elements

  • Functional Context Analysis:

Species TypeRepresentative SpeciesGenomic Context FeaturesPotential Functional Implications
PathogenicB. cereus, B. anthracisCo-localization with virulence factorsRole in toxin secretion or resistance
OpportunisticB. thuringiensisAssociation with insecticidal proteinsInvolvement in specialized secretion
Non-pathogenicB. subtilisMetabolic gene clustersBasic cellular functions
  • Host Interaction Potential:

    • Compare protein surface properties that might interact with host factors

    • Identify potential mimicry of host proteins or binding sites

    • Analyze sequence variations in regions exposed to host immune system

    • Assess potential roles in antimicrobial resistance mechanisms

  • Evolutionary History Reconstruction:

    • Build phylogenetic trees of UPF0316 family proteins across Bacillus species

    • Identify horizontal gene transfer events that might indicate functional importance

    • Correlate protein evolution with pathogenicity acquisition

    • Analyze gene gain/loss patterns across species transitions

This comparative approach may reveal whether BCAH187_A3394 contributes to Bacillus cereus pathogenicity, which includes food poisoning and more severe infections, and could suggest potential roles in virulence or host adaptation .

How do the antimicrobial resistance profiles correlate with BCAH187_A3394 expression across different Bacillus cereus strains?

Investigating the relationship between BCAH187_A3394 expression and antimicrobial resistance provides insights into potential functional roles in stress response:

  • Expression-Resistance Correlation Analysis:

    • Measure BCAH187_A3394 expression levels across multiple B. cereus strains using RT-qPCR

    • Determine minimum inhibitory concentrations (MICs) for a panel of antibiotics for each strain

    • Perform statistical correlation analysis between expression levels and resistance profiles

    • Analyze induction of expression upon antibiotic exposure

  • Antibiotic Panel Selection:

    • Include β-lactams (to which B. cereus is typically resistant )

    • Test vancomycin, gentamicin, chloramphenicol, and carbapenems (typically effective )

    • Include clindamycin, tetracycline, and erythromycin (variable results )

    • Add membrane-targeting antibiotics (polymyxins, daptomycin) given the protein's membrane localization

  • Experimental Validation Approaches:

    • Create BCAH187_A3394 knockout and overexpression strains

    • Compare antibiotic susceptibility profiles using standardized methods

    • Perform time-kill kinetics to assess dynamics of antimicrobial action

    • Evaluate biofilm formation capacity and antibiotic tolerance

  • Mechanistic Investigation:

    • Analyze membrane integrity with and without BCAH187_A3394 expression

    • Assess potential roles in efflux or permeability using fluorescent dye accumulation

    • Measure expression of known resistance genes in wild-type versus mutant strains

    • Investigate potential interactions with resistance determinants

  • Clinical Correlation:

    • Compare BCAH187_A3394 sequences from clinical versus environmental isolates

    • Correlate expression levels with isolation source and clinical outcomes

    • Analyze co-occurrence with known resistance determinants

    • Evaluate potential as a biomarker for specific resistance patterns

What are the most promising applications of BCAH187_A3394 research in biotechnology and medicine?

Research on BCAH187_A3394 holds potential for several impactful applications in biotechnology and medicine:

  • Antimicrobial Drug Development:

    • If confirmed as involved in antimicrobial resistance, BCAH187_A3394 could represent a novel drug target

    • Structure-based drug design targeting this membrane protein could yield compounds that sensitize B. cereus to existing antibiotics

    • Understanding its function might reveal new vulnerability points in bacterial membranes

    • Potential for broad-spectrum applications if conserved across pathogenic Bacillus species

  • Biotechnological Applications:

    • If involved in membrane transport, potential use in engineered biosynthetic pathways for improved product secretion

    • Possible application in biosensor development if the protein responds to specific environmental signals

    • Potential use in protein engineering platforms for membrane protein display or stabilization

    • Possible utility in creating bacterial membrane protein expression systems with improved yield

  • Basic Science Impacts:

    • Contribution to understanding the functional diversity of membrane proteins

    • Insights into bacterial adaptation mechanisms to different environments

    • Elucidation of poorly understood aspects of Bacillus cereus physiology

    • Advances in membrane protein structural biology techniques

  • Diagnostic Applications:

    • Development of specific antibodies against BCAH187_A3394 for rapid detection of B. cereus

    • Potential biomarker for specific B. cereus strains associated with pathogenicity

    • Target for nucleic acid-based detection methods with increased specificity

    • Integration into multi-target detection panels for food safety applications

The translational potential of this research depends on definitive functional characterization, but given B. cereus's relevance in food poisoning and opportunistic infections , advances could have significant public health implications.

What key questions remain unanswered about BCAH187_A3394 and how might future research address them?

Despite current research efforts, significant knowledge gaps remain regarding BCAH187_A3394:

  • Fundamental Function Determination:

    • Key Question: What is the primary molecular function of BCAH187_A3394?

    • Research Approach: Combine structural studies (cryo-EM, X-ray crystallography) with systematic functional assays targeting potential activities (transport, signaling, membrane organization)

    • Technical Challenges: Membrane protein expression, purification, and reconstitution in functional assay systems

    • Innovative Solutions: Apply native mass spectrometry to identify binding partners, implement high-throughput screening for substrates

  • Physiological Role Clarification:

    • Key Question: Under what conditions is BCAH187_A3394 essential for B. cereus survival?

    • Research Approach: Comprehensive phenotypic characterization of knockout strains under diverse stress conditions, in vivo infection models

    • Technical Challenges: Potential redundancy masking phenotypes, complex environmental interactions

    • Innovative Solutions: Apply Tn-Seq for genetic interaction mapping, implement CRISPR interference for temporal regulation studies

  • Structural Dynamics Understanding:

    • Key Question: How does BCAH187_A3394 change conformation during its functional cycle?

    • Research Approach: Single-molecule FRET, molecular dynamics simulations, time-resolved structural methods

    • Technical Challenges: Capturing transient states, labeling membrane proteins without functional disruption

    • Innovative Solutions: Develop novel spectroscopic approaches, implement computational enhanced sampling methods

  • Evolutionary Context Elucidation:

    • Key Question: How has BCAH187_A3394 evolved across bacterial species and what selective pressures have shaped it?

    • Research Approach: Comprehensive phylogenetic analysis, ancestral sequence reconstruction, horizontal gene transfer analysis

    • Technical Challenges: Limited functional annotation of homologs, complex evolutionary history

    • Innovative Solutions: Develop machine learning approaches for functional prediction from sequence alone

  • Therapeutic Potential Exploration:

    • Key Question: Can BCAH187_A3394 be exploited as a drug target or biotechnological tool?

    • Research Approach: High-throughput screening for inhibitors, structure-based drug design, protein engineering

    • Technical Challenges: Specificity concerns, membrane accessibility of compounds

    • Innovative Solutions: Fragment-based drug discovery specifically for membrane proteins, nanobody development

Addressing these questions will require interdisciplinary approaches combining structural biology, genetics, biochemistry, computational biology, and microbiology to fully understand this enigmatic protein.

How might systems biology approaches enhance our understanding of BCAH187_A3394's role in Bacillus cereus physiology?

Systems biology offers powerful frameworks to contextualize BCAH187_A3394 within the broader cellular network:

  • Multi-omics Integration Strategies:

    • Combine transcriptomics, proteomics, and metabolomics data from wild-type and BCAH187_A3394 mutants

    • Perform differential expression analysis across diverse conditions

    • Map protein-protein interactions using AP-MS and proximity labeling

    • Correlate metabolic changes with expression patterns to infer functional pathways

  • Network Biology Approaches:

    • Construct protein interaction networks centered on BCAH187_A3394

    • Identify functional modules associated with the protein

    • Apply network perturbation analysis to predict system-wide effects of protein modulation

    • Perform topological analysis to assess centrality and importance within cellular networks

  • Genome-Scale Modeling Framework:

Modeling ApproachImplementation MethodExpected InsightsValidation Strategy
Constraint-based modelingIncorporate BCAH187_A3394 into genome-scale metabolic modelsMetabolic impact predictionsGrowth phenotype matching
Kinetic modelingDevelop focused models of membrane processesDynamic behavior understandingTime-course experimental data
Agent-based modelsSimulate cell population behaviorsEmergent properties at population levelMicroscopy and flow cytometry
Machine learning integrationPredict functional relationships from multi-omics dataNovel interaction discoveryTargeted experimental validation
  • Comparative Systems Approaches:

    • Compare system-wide responses across multiple Bacillus species

    • Identify conserved versus species-specific network motifs

    • Analyze the evolutionary conservation of functional modules

    • Develop cross-species network alignment methods

  • Environmental and Ecological Context:

    • Model how BCAH187_A3394-related processes respond to environmental changes

    • Simulate host-pathogen interactions at the systems level

    • Analyze community effects in polymicrobial contexts

    • Develop predictive models for strain behavior in food matrices

These systems approaches will help position BCAH187_A3394 within its biological context, revealing not just its individual function but its role in the broader adaptive strategies of Bacillus cereus to various environmental challenges and stresses.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.