Recombinant Bacillus cereus UPF0316 protein BCAH820_3389 (BCAH820_3389)

Shipped with Ice Packs
In Stock

Product Specs

Form
Supplied as a lyophilized powder.

Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.

Note: Proteins are shipped with standard blue ice packs. Dry ice shipping requires advance notification and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to pellet the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a reference.
Shelf Life
Shelf life depends on several factors, including storage conditions, buffer composition, temperature, and the protein's inherent stability.
Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.

Note: While the tag type is determined during production, we can prioritize the development of a specific tag type if requested. Please specify your requirements.
Synonyms
BCAH820_3389; UPF0316 protein BCAH820_3389
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-182
Protein Length
full length protein
Species
Bacillus cereus (strain AH820)
Target Names
BCAH820_3389
Target Protein Sequence
MLQALLIFVLQIIYVPILTIRTILLVKNQTRSAAAVGLLEGAIYIVSLGIVFQDLSNWMN IVAYVIGFSAGLLLGGYIENKLAIGYITYQVSLLDRCNELVDELRHSGFGVTVFEGEGIN SIRYRLDIVAKRSREKELLEIINEIAPKAFMSSYEIRSFKGGYLTKAMKKRALMKKKDHH VS
Uniprot No.

Target Background

Database Links
Protein Families
UPF0316 family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is Recombinant Bacillus cereus UPF0316 protein BCAH820_3389?

Recombinant Bacillus cereus UPF0316 protein BCAH820_3389 is a member of the UPF0316 protein family expressed in Bacillus cereus. It is classified as a multi-pass membrane protein with predicted transmembrane domains, similar to other characterized UPF0316 family proteins like BCE33L3064 . The protein is typically expressed in recombinant systems like E. coli for research purposes. The "UPF" designation indicates an uncharacterized protein family whose functions are still being elucidated through ongoing research.

How does BCAH820_3389 compare structurally to other UPF0316 family proteins?

BCAH820_3389 shares significant sequence homology with other UPF0316 family proteins, including BCE33L3064, with conserved transmembrane domains and motifs characteristic of the family. Based on structural analysis of UPF family proteins, BCAH820_3389 likely contains multiple alpha-helical transmembrane segments that anchor the protein within the cell membrane . Unlike better-characterized UPF proteins such as UPF3, which contains RNA-recognition motif-like domains (RRM-L) and NONA/paraspeckle-like domains (NOPS-L), BCAH820_3389's domain architecture appears to be primarily focused on membrane integration .

What is the predicted subcellular localization of BCAH820_3389?

BCAH820_3389 is predicted to be a multi-pass membrane protein localized to the bacterial cell membrane, similar to other characterized UPF0316 family members . This localization is consistent with its predicted transmembrane topology and suggests potential roles in membrane transport, signaling, or structural integrity. Experimental verification of this localization typically requires fluorescent tagging or subcellular fractionation followed by Western blot analysis.

What expression systems are optimal for recombinant BCAH820_3389 production?

For optimal expression of recombinant BCAH820_3389, E. coli-based expression systems are commonly employed, particularly for initial characterization studies. The choice of expression vector should include:

When expressing BCAH820_3389, optimization of induction conditions (temperature, IPTG concentration, induction time) is critical for obtaining properly folded protein . For membrane proteins like BCAH820_3389, lower induction temperatures (16-20°C) often improve proper folding and membrane insertion.

What purification strategies are most effective for BCAH820_3389?

Purification of recombinant BCAH820_3389 typically involves:

  • Addition of an affinity tag (commonly His-tag as seen with similar proteins)

  • Cell lysis and membrane fraction isolation

  • Solubilization using appropriate detergents

  • Affinity chromatography

  • Size exclusion chromatography for final purification

A methodological approach for detergent screening is crucial as different detergents may affect protein stability and activity:

DetergentCMC (mM)AdvantagesRecommended Concentration
DDM0.17Mild, maintains function1-2% for extraction, 0.05% for purification
LMNG0.01High stability0.5-1% for extraction, 0.01% for purification
Digitonin0.5Native-like environment0.5-1% for both steps

Buffer optimization should include stabilizing agents such as glycerol (10-15%) and appropriate salt concentrations (typically 150-300 mM NaCl) .

What computational methods are recommended for predicting BCAH820_3389 structure and function?

For structural prediction of BCAH820_3389, a multi-step computational approach is recommended:

  • Sequence-based prediction: Tools like TMHMM and TOPCONS for transmembrane topology prediction

  • Homology modeling: Using resolved structures of homologous UPF proteins as templates

  • AI-based prediction: Implementation of AlphaFold2 or similar tools for ab initio structure prediction

  • Molecular dynamics simulations: To assess stability in membrane environments

For functional prediction, researchers should:

  • Perform phylogenetic analysis to identify conservation patterns

  • Use tools like InterProScan for domain and motif identification

  • Apply gene neighborhood analysis to identify functional associations

  • Consider protein-protein interaction network prediction using STRING database

These approaches can help generate testable hypotheses about the function of this uncharacterized protein family member.

How can researchers investigate protein-protein interactions involving BCAH820_3389?

Investigation of protein-protein interactions for BCAH820_3389 should employ complementary approaches:

  • Pull-down assays: Using purified His-tagged BCAH820_3389 as bait protein

  • Bacterial two-hybrid systems: Particularly useful for membrane proteins

  • Cross-linking mass spectrometry: For capturing transient interactions

  • Co-immunoprecipitation: If specific antibodies are available

  • Proximity labeling approaches: Such as BioID or APEX2 fusion proteins

When analyzing protein interactions, careful validation using multiple methods is essential to distinguish genuine interactions from non-specific binding. For membrane proteins like BCAH820_3389, detergent choice can significantly impact interaction detection, with milder detergents generally preferred for maintaining interaction integrity .

How might BCAH820_3389 contribute to bacterial physiology?

Based on its classification as a multi-pass membrane protein, BCAH820_3389 may play roles in:

  • Membrane integrity: Contributing to cell envelope stability

  • Transport functions: Facilitating movement of molecules across the membrane

  • Signaling pathways: Transducing environmental signals

  • Stress response: Adaptation to changing environmental conditions

Research approaches to elucidate these roles should include:

  • Gene knockout/knockdown studies followed by phenotypic analysis

  • Transcriptomic profiling under various stress conditions

  • Metabolomic analysis to identify changes in cellular metabolites

  • Membrane permeability and potential measurements in mutant strains

With UPF0316 family proteins being conserved across Bacillus species, comparative functional genomics approaches can provide valuable insights into their biological significance .

What methodologies are applicable for studying the role of BCAH820_3389 in bacterial pathogenesis?

To investigate potential roles in pathogenesis:

  • Virulence model systems: Use of invertebrate (G. mellonella, C. elegans) and mammalian infection models with BCAH820_3389 knockout strains

  • Adhesion and invasion assays: Quantification of bacterial interaction with host cells

  • Biofilm formation assays: Assessment of biofilm formation capacity

  • Immune response characterization: Measurement of host immune responses to mutant vs. wild-type bacteria

  • Comparative genomics: Analysis of BCAH820_3389 conservation across pathogenic and non-pathogenic Bacillus strains

These approaches should be complemented with in vitro characterization of protein function to establish mechanistic links between BCAH820_3389 and virulence phenotypes.

How can researchers reconcile contradictory experimental results regarding BCAH820_3389?

When facing contradictory results:

  • Systematic validation: Repeat experiments with standardized protocols and multiple biological replicates

  • Parameter analysis: Identify and control variation sources (expression conditions, purification methods, buffer compositions)

  • Contradiction pattern analysis: Apply structured contradiction assessment using the (α, β, θ) notation method

    • α: number of interdependent items

    • β: number of contradictory dependencies defined by domain experts

    • θ: minimal number of required Boolean rules to assess contradictions

For complex contradictions involving multiple parameters (e.g., expression conditions, purification methods, activity measurements), implementing a formal contradiction resolution framework can substantially reduce the complexity of analysis .

What quality control measures are essential when working with recombinant BCAH820_3389?

Essential quality control measures include:

Quality ParameterMethodAcceptance Criteria
PuritySDS-PAGE, SEC-MALS>90% purity, monodisperse peak
IdentityMass spectrometry, Western blotMatches theoretical mass, specific antibody recognition
IntegrityN-terminal sequencing, LC-MS/MSConfirmed sequence, intact termini
FunctionalityActivity assays, thermal shiftStable melting curve, reproducible activity
HomogeneityDLS, analytical SECPDI <0.2, symmetric peak profile

For membrane proteins like BCAH820_3389, additional quality controls should include verification of proper membrane incorporation using liposome reconstitution experiments and assessment of secondary structure integrity via circular dichroism spectroscopy .

What are the critical parameters for optimizing BCAH820_3389 expression and solubility?

Optimization of BCAH820_3389 expression requires careful attention to:

  • Expression temperature: Lower temperatures (16-20°C) often improve membrane protein folding

  • Induction conditions: IPTG concentration between 0.1-0.5 mM typically balances yield and proper folding

  • Expression duration: Extended periods (16-24 hours) at lower temperatures often yield better results

  • Media composition: Supplementation with glycerol (0.5-1%) and specific metal ions may enhance expression

  • Host strain selection: C41/C43 or Lemo21(DE3) strains often perform better for membrane proteins

A systematic optimization approach using design of experiments (DOE) methodology is recommended to efficiently identify optimal conditions through factorial experimental design rather than one-factor-at-a-time optimization .

How can researchers address challenges in BCAH820_3389 crystallization for structural studies?

Crystallization of membrane proteins like BCAH820_3389 presents unique challenges that can be addressed through:

  • Construct optimization: Creation of multiple constructs with variable N/C-terminal boundaries

  • Detergent screening: Systematic testing of different detergents and mixed micelle systems

  • Lipidic cubic phase (LCP) crystallization: Often more successful for membrane proteins than vapor diffusion

  • Fusion partner approach: Addition of crystallization chaperones like T4 lysozyme or BRIL

  • Surface entropy reduction: Mutation of surface residues to reduce entropy and promote crystal contacts

For proteins refractory to crystallization, researchers should consider alternative structural determination methods such as cryo-EM, which has revolutionized membrane protein structural biology by eliminating the need for crystal formation .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.