Recombinant Bacillus cereus UPF0316 protein BCB4264_A3368 (BCB4264_A3368)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your format preference during ordering for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires advance notification and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on several factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
BCB4264_A3368; UPF0316 protein BCB4264_A3368
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-182
Protein Length
full length protein
Species
Bacillus cereus (strain B4264)
Target Names
BCB4264_A3368
Target Protein Sequence
MLQALLIFVLQIIYVPILTIRTILLVKNQTRSAAGVGLLEGAIYIVSLGIVFQDLSNWMN IVAYVIGFSAGLLLGGYIENKLAIGYITYQVSLLDRCNELVDELRHSGFGVTVFEGEGIN SIRYRLDIVAKRSREKELLEIINEIAPKAFMSSYEIRSFKGGYLTKAMKKRALMKKKDEH AS
Uniprot No.

Target Background

Database Links
Protein Families
UPF0316 family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What expression systems are recommended for BCB4264_A3368 production?

Escherichia coli is the most validated expression system for BCB4264_A3368 production, particularly using strains optimized for heterologous protein expression such as BL21(DE3). The commercially available recombinant protein is produced using an E. coli expression system with an N-terminal His-tag for purification purposes .

When designing expression experiments, researchers should consider:

  • Codon optimization for E. coli, particularly for rare codons in the original B. cereus sequence

  • Selection of appropriate promoter systems (T7, tac, or araBAD) based on desired expression levels

  • Induction parameters (temperature, IPTG concentration, induction duration)

  • Co-expression with chaperone proteins if misfolding is observed

Recent research on recombinant protein expression indicates that the accessibility of translation initiation sites significantly affects expression outcomes, with approximately 50% of recombinant proteins failing expression in various host cells . Optimization of the translation initiation region through synonymous codon changes may significantly improve expression yields .

What purification strategies are effective for BCB4264_A3368?

Given the His-tagged nature of the recombinant BCB4264_A3368 protein, immobilized metal affinity chromatography (IMAC) is the primary purification method. A methodological approach includes:

  • Cell lysis: Sonication or mechanical disruption in a Tris/PBS-based buffer (pH 8.0) with protease inhibitors

  • IMAC purification: Using Ni-NTA or cobalt-based resins with imidazole gradient elution

  • Secondary purification: Size exclusion chromatography to increase purity beyond 90%

  • Storage considerations: The protein is typically supplied as a lyophilized powder and should be reconstituted in deionized sterile water to 0.1-1.0 mg/mL

For long-term storage, addition of 5-50% glycerol (final concentration) and aliquoting for storage at -20°C/-80°C is recommended to avoid repeated freeze-thaw cycles . The storage buffer typically contains Tris/PBS with 6% trehalose at pH 8.0 to maintain protein stability .

How does the structure of BCB4264_A3368 relate to potential functions in B. cereus?

While no experimentally determined structure for BCB4264_A3368 is currently available in the Protein Data Bank, structural prediction approaches suggest features consistent with membrane association. The protein contains hydrophobic stretches (visible in the sequence "MLQALLIFVLQIIYVPILTIRT") that likely form transmembrane domains .

For researchers investigating structure-function relationships, a multi-faceted approach is recommended:

  • Homology modeling: Utilize related UPF0316 family proteins with known structures

  • Secondary structure prediction: Tools such as PSIPRED, JPred to identify α-helices and β-sheets

  • Transmembrane domain prediction: TMHMM, Phobius, or TOPCONS can identify potential membrane-spanning regions

  • Molecular dynamics simulations: To understand potential conformational changes in membrane environments

The predicted membrane association may suggest roles in transport, signaling, or maintaining cell envelope integrity. Any functional hypotheses should be experimentally validated through deletion studies, protein-protein interaction assays, or phenotypic characterization of knockout mutants.

What considerations are important when designing experiments to determine BCB4264_A3368 function?

When designing experiments to elucidate the function of this uncharacterized protein, researchers should implement a comprehensive strategy:

  • Comparative genomics approach: Analyze gene neighborhood and conservation patterns across Bacillus species

  • Transcriptomic profiling: Determine expression conditions and co-expressed genes

  • Protein-protein interaction studies: Pull-down assays using the His-tagged protein to identify interaction partners

  • Phenotypic characterization of knockout mutants: Generate gene deletion strains to observe phenotypic changes

  • Heterologous expression impact: Assess effects of overexpression in model systems

When analyzing results, it's critical to consider that B. cereus is known for its pathogenicity and contains multiple virulence factors. Research shows that 35% of ready-to-eat food samples tested positive for B. cereus, with isolates containing various toxin genes like hblACD (39%) and nheABC (83%) . Understanding whether BCB4264_A3368 contributes to virulence or survival mechanisms should be contextualized within this pathogenicity framework.

How can translation initiation optimization improve BCB4264_A3368 expression yields?

Recent research on 11,430 recombinant protein production experiments demonstrates that protein yield can be significantly impacted by synonymous codon changes at translation initiation sites . For BCB4264_A3368 expression optimization:

  • Analyze the accessibility of translation initiation sites using mRNA base-unpairing across Boltzmann's ensemble

  • Implement synonymous codon changes in the first 5-10 codons to optimize ribosome binding

  • Consider the impact of secondary structures near the start codon

  • Test multiple constructs with varying 5' UTR sequences

The research indicates that the accessibility of translation initiation sites is a significantly better predictor of expression success than alternative features . Failed expression experiments (approximately 50% of attempts) can often be rescued through this approach without altering the amino acid sequence of the protein.

What implications might BCB4264_A3368 have for B. cereus pathogenicity and virulence?

While direct evidence linking BCB4264_A3368 to pathogenicity is currently lacking, understanding its potential role requires consideration of B. cereus virulence mechanisms:

  • B. cereus produces various toxins, with 39% of isolates harboring the enterotoxin-encoding hblACD gene cluster and 83% containing the nheABC gene cluster

  • The cytK gene is present in 68% of isolates, while only 7% harbor the emetic toxin-encoding cesB gene

  • All B. cereus isolates studied possessed the entFM gene

  • Multilocus sequence typing (MLST) analysis reveals significant genetic diversity, with 192 different sequence types identified among 368 isolates

To investigate potential contributions of BCB4264_A3368 to virulence:

  • Compare expression levels across virulent and avirulent strains

  • Assess impact of gene deletion on toxin production and secretion

  • Evaluate protein expression under conditions mimicking host infection

  • Test for interactions with known virulence factors or regulatory systems

Antimicrobial resistance patterns should also be considered, as most B. cereus isolates show resistance to β-lactam antibiotics and rifamycin , which may influence treatment strategies if BCB4264_A3368 is found to contribute to pathogenicity.

What analytical techniques are recommended for characterizing purified BCB4264_A3368?

A comprehensive characterization should employ multiple complementary techniques:

Analytical TechniqueApplicationExpected Outcome
SDS-PAGEPurity assessment>90% purity with expected MW ~20 kDa plus tag
Western blottingIdentity confirmationSpecific binding with anti-His antibodies
Mass spectrometryPrecise mass determinationExact mass matching theoretical prediction
Circular dichroismSecondary structure analysisα-helical content consistent with predictions
Size exclusion chromatographyOligomeric state determinationMonomeric or specific oligomeric form
Dynamic light scatteringHomogeneity assessmentMonodisperse preparation with defined radius

For functional characterization, researchers should consider:

  • Membrane incorporation assays using liposomes

  • Binding studies with potential interacting partners

  • Activity assays based on bioinformatic predictions of function

Quality control should confirm that the protein's purity is greater than 90% as determined by SDS-PAGE and that the protein maintains its expected folding state after purification .

How can researchers address solubility challenges with BCB4264_A3368?

Membrane-associated proteins like BCB4264_A3368 often present solubility challenges. A systematic approach to improving solubility includes:

  • Expression modifications:

    • Lower induction temperature (16-25°C)

    • Reduced inducer concentration

    • Co-expression with chaperones (GroEL/GroES, DnaK/DnaJ)

  • Construct optimization:

    • Testing different fusion tags (MBP, SUMO, GST)

    • Domain truncation to remove highly hydrophobic regions

    • Terminal extensions to improve folding

  • Lysis and purification conditions:

    • Inclusion of mild detergents (n-dodecyl-β-D-maltoside, CHAPS)

    • Use of arginine or proline in buffers to enhance solubility

    • Extraction using higher salt concentrations

  • Refolding strategies (if isolated from inclusion bodies):

    • Gradient dialysis to remove denaturants

    • On-column refolding during affinity purification

    • Assisted refolding with molecular chaperones

For reconstitution, it's recommended to centrifuge the vial briefly before opening and to reconstitute in deionized sterile water to a concentration of 0.1-1.0 mg/mL . The addition of glycerol to a final concentration of 5-50% is suggested for long-term storage, with 50% being the standard concentration used in commercial preparations .

What computational approaches can predict potential functions of BCB4264_A3368?

Given the uncharacterized nature of UPF0316 family proteins, bioinformatic approaches are crucial for hypothesis generation:

  • Sequence-based analyses:

    • PSI-BLAST to identify distant homologs with known functions

    • Conserved domain analysis using CDD, SMART, or Pfam

    • Identification of functional motifs using PROSITE

  • Structural prediction approaches:

    • AlphaFold2 or RoseTTAFold for tertiary structure prediction

    • Binding site prediction using CASTp or SiteMap

    • Molecular docking with potential ligands

  • Genomic context analysis:

    • Operon structure investigation

    • Co-occurrence patterns across bacterial species

    • Phylogenetic profiling to identify functional partners

  • Network-based approaches:

    • Protein-protein interaction prediction

    • Integration with metabolic networks

    • Co-expression network analysis

Research indicates that translation initiation sites are crucial for successful protein expression . When comparing BCB4264_A3368 sequences across strains, analyzing the accessibility of translation initiation sites using mRNA base-unpairing across Boltzmann's ensemble can provide insights into expression efficiency differences .

How does BCB4264_A3368 relate to other UPF0316 family proteins across bacterial species?

The UPF0316 protein family is found across multiple bacterial genera, with varying degrees of sequence conservation. To understand evolutionary relationships and functional implications:

  • Phylogenetic analysis workflow:

    • Multiple sequence alignment of UPF0316 homologs

    • Maximum likelihood or Bayesian phylogenetic tree construction

    • Reconciliation with species phylogeny to identify orthology/paralogy

  • Functional divergence assessment:

    • Identification of conserved vs. variable regions

    • Detection of sites under positive selection

    • Analysis of co-evolving residues

  • Comparative genomics:

    • Synteny analysis across bacterial genomes

    • Identification of gene gain/loss events

    • Correlation with ecological niches or pathogenicity

MLST (Multilocus Sequence Typing) analysis of B. cereus isolates reveals significant genetic diversity, with 192 different sequence types identified among 368 isolates, including 93 novel sequence types . This diversity suggests potential functional variations in proteins across strains, including UPF0316 family proteins like BCB4264_A3368. When comparing sequence types, ST26 was found to be the most abundant (28 isolates), followed by ST205 (14 isolates) , potentially providing reference strains for comparative studies.

What are common challenges in BCB4264_A3368 expression and purification and how can they be addressed?

Researchers commonly encounter several challenges when working with recombinant BCB4264_A3368:

ChallengePotential CausesTroubleshooting Strategies
Low expression yieldsPoor translation initiation, codon bias, toxicityOptimize translation initiation sites, use codon-optimized genes, use tightly regulated expression systems
Inclusion body formationRapid expression, improper foldingLower induction temperature, reduce inducer concentration, co-express with chaperones
Poor solubilityHydrophobic regions, membrane associationInclude appropriate detergents, optimize buffer conditions, use solubility-enhancing tags
Degradation during purificationProtease activity, unstable proteinAdd protease inhibitors, reduce purification time, maintain cold temperatures
Low purity after IMACNon-specific binding to resinIncrease imidazole in wash buffers, try alternative purification methods

Research indicates that approximately 50% of recombinant proteins fail to be expressed in various host cells . For BCB4264_A3368, the accessibility of translation initiation sites modeled using mRNA base-unpairing across Boltzmann's ensemble can significantly improve expression outcomes through synonymous codon changes .

How can researchers validate the functional integrity of purified BCB4264_A3368?

Validating functional integrity requires both structural and functional assessments:

  • Structural integrity assessments:

    • Circular dichroism to confirm secondary structure content

    • Intrinsic fluorescence to assess tertiary structure

    • Thermal shift assays to determine stability

    • Limited proteolysis to confirm proper folding

  • Functional validation approaches:

    • Binding assays with predicted interaction partners

    • Functional complementation in knockout strains

    • In vitro reconstitution of predicted activities

    • Membrane incorporation studies if transmembrane domains are present

  • Quality control parameters:

    • Monodispersity by dynamic light scattering

    • Batch-to-batch consistency verification

    • Activity retention after storage and freeze-thaw cycles

    • Endotoxin testing for downstream applications

For storage and handling, avoid repeated freeze-thaw cycles, store working aliquots at 4°C for up to one week, and maintain long-term storage at -20°C/-80°C . For reconstitution, centrifuge the vial briefly before opening and reconstitute in deionized sterile water to a concentration of 0.1-1.0 mg/mL .

What are the most promising research avenues for understanding BCB4264_A3368 function?

Based on current knowledge gaps and technical capabilities, several promising research directions emerge:

  • Structure determination: Pursue X-ray crystallography, cryo-EM, or NMR studies to resolve the three-dimensional structure

  • Genetic approaches: Utilize CRISPR-Cas9 to create knockout strains and assess phenotypic changes

  • Localization studies: Implement fluorescent protein fusions to determine subcellular localization

  • Interactome mapping: Perform comprehensive protein-protein interaction studies using AP-MS or BioID

  • Condition-dependent expression: Analyze expression under various stress conditions and in infection models

These approaches should be contextualized within the broader understanding of B. cereus pathogenicity. Given that B. cereus is found in 35% of ready-to-eat food samples and shows resistance to multiple antibiotics , understanding the role of all proteins, including uncharacterized ones like BCB4264_A3368, is crucial for developing new control strategies.

How might BCB4264_A3368 research contribute to understanding B. cereus pathogenicity?

Investigating BCB4264_A3368 could provide valuable insights into B. cereus pathogenicity through several mechanisms:

  • If involved in membrane integrity, it may affect resistance to antimicrobial compounds

  • As a potential transporter, it could contribute to toxin secretion or nutrient acquisition during infection

  • If part of stress response systems, it may enhance survival in host environments

  • Understanding its structure could reveal novel targets for antimicrobial development

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.