Recombinant Bacillus cereus UPF0316 protein BCE_3390 (BCE_3390) is a protein that, when expressed in E. coli, is fused to an N-terminal His tag . It is associated with the gene BCE_3390 and is also known as UPF0316 protein BCE_3390 . The protein is available as a lyophilized powder with a purity greater than 90% as determined by SDS-PAGE .
| Feature | Description |
|---|---|
| Cat.No. | RFL2676BF |
| Species | Bacillus cereus |
| Source | E. coli |
| Tag | His |
| Protein Length | Full Length (1-182 aa) |
| Form | Lyophilized powder |
| AA Sequence | MLQALLIFVLQIIYVPILTIRTILLVKNQTRSAAGVGLLEGAIYIVSLGIVFQDLSNWMN IVAYVIGFSAGLLLGGYIENKLAIGYITYQVSLLDRCNELVDELRHSGFGVTVFEGEGIN SIRYRLDIVAKRSREKELLEIINEIAPKAFMSSYEIRSFKGGYLTKAMKKRALMKKKDEH AS |
| Purity | Greater than 90% as determined by SDS-PAGE |
| Storage | Store at -20°C/-80°C upon receipt, aliquoting is necessary for multiple use. Avoid repeated freeze-thaw cycles. |
| Storage Buffer | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
| Reconstitution | Reconstitute in deionized sterile water to a concentration of 0.1-1.0 mg/mL. Add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. |
| Gene Name | BCE_3390 |
| Synonyms | BCE_3390; UPF0316 protein BCE_3390 |
| UniProt ID | P61546 |
Bacillus cereus is a bacterium commonly found in various environments, including soil, vegetation, and food . It is known for producing toxins that can cause food poisoning . Bacillus cereus utilizes various proteins and mechanisms to adapt to its environment and compete with other microorganisms . Research has identified proteins involved in glucose catabolism, stress response, and multidrug resistance in Bacillus cereus .
EntD Protein: Proteomic analysis of Bacillus cereus has identified EntD as a novel exoprotein involved in glucose catabolism . Disruption of entD impacts glucose catabolism in an oxygen-independent manner .
BC3310 Efflux Pump: BC3310, a multidrug efflux pump in Bacillus cereus, confers resistance to ethidium bromide, SDS, and silver nitrate . It is part of the "unknown major facilitator family-2" (UMF-2) .
Certhrax Toxin: Bacillus cereus strain G9241 expresses the Certhrax toxin, which ADP-ribosylates vinculin, disrupting actin cytoskeleton interactions .
ComK Proteins: Research suggests that the regulation of gene expression by ComK proteins in B. cereus differs significantly from that known in B. subtilis .
KEGG: bca:BCE_3390
BCE_3390 is a protein belonging to the UPF0316 family found in Bacillus cereus. It is a full-length protein consisting of 182 amino acids (1-182aa) and has been assigned the UniProt ID P61546 . The UPF (Uncharacterized Protein Family) designation indicates that while the protein has been identified and sequenced, its precise biological function remains incompletely characterized. The protein belongs to B. cereus, a Gram-positive, facultatively anaerobic bacterium that forms endospores and is known for causing foodborne illnesses .
The complete amino acid sequence of BCE_3390 has been determined and consists of 182 amino acids. The sequence is as follows:
MLQALLIFVLQIIYVPILTIRTILLVKNQTRSAAGVGLLEGAIYIVSLGIVFQDLSNWMNIVAYVIGFSAGLLLGGYIENKLAIGYITYQVSLLDRCNELVDELRHSGFGVTVFEGEGINSIRYRLDIVAKREREKELLEIINEIAPKAFMSSYEIRSFKGGYLTKAMKKRALMKKKDEHAS
Analysis of this sequence suggests several hydrophobic regions, which may indicate membrane-spanning domains. The presence of charged residues at specific positions might be important for protein-protein interactions or functional activities.
Based on the amino acid sequence, BCE_3390 appears to have several hydrophobic regions, particularly at the N-terminus (MLQALLIFVLQIIYVPILTIRTILLVKN), suggesting possible membrane association or transmembrane domains. The protein contains multiple charged residues (such as arginine, lysine, and glutamic acid) distributed throughout its sequence, which may be involved in electrostatic interactions with other proteins or nucleic acids.
The presence of glycine residues at specific positions may provide flexibility to certain regions of the protein. Secondary structure prediction algorithms would likely identify alpha-helical regions due to the distribution of hydrophobic residues. While the search results don't explicitly describe the 3D structure, proteins in the UPF0316 family typically share conserved structural motifs that might provide clues about BCE_3390's function.
While the direct role of BCE_3390 in B. cereus pathogenicity is not explicitly described in the search results, B. cereus is known to cause foodborne illnesses characterized by two types of syndromes: an emetic (vomiting) syndrome and a diarrheal syndrome . The pathogenicity of B. cereus involves various virulence factors, including the emetic toxin synthetase gene cluster (ces gene cluster) and diarrheal toxins .
Researchers investigating BCE_3390 should consider potential relationships between this protein and known virulence mechanisms. B. cereus strains isolated from foodborne outbreaks have been found to contain numerous virulence factors, including complete ces gene clusters that encode emetic toxins synthesized via the NRPS (Non-Ribosomal Peptide Synthetase) system . Further research is needed to determine if BCE_3390 interacts with any of these pathogenicity pathways.
Based on the available information, recombinant BCE_3390 has been successfully expressed in E. coli expression systems . This approach is common for bacterial proteins due to its efficiency and scalability. For optimal expression:
Vector selection: pET-based vectors with T7 promoters are frequently used for high-level expression.
E. coli strain: BL21(DE3) or derivatives are recommended due to their protease deficiency.
Induction conditions: IPTG concentration (typically 0.1-1.0 mM), temperature (16-37°C), and duration (3-16 hours) should be optimized.
Growth media: Rich media (LB) for standard expression, or minimal media for isotope labeling in structural studies.
For membrane-associated proteins like BCE_3390 (which appears to have hydrophobic regions), specialized approaches may be necessary:
Lower induction temperatures (16-25°C) to reduce inclusion body formation
Addition of solubilizing agents or detergents
Consideration of cell-free expression systems for highly hydrophobic proteins
Alternative expression systems (yeast, insect cells) could be explored if E. coli expression yields insufficient soluble protein, though these were not mentioned in the search results.
The search results indicate that BCE_3390 has been produced with an N-terminal His tag , which facilitates purification by immobilized metal affinity chromatography (IMAC). A comprehensive purification strategy would include:
Initial IMAC purification:
Ni-NTA or Co-based resins
Imidazole gradient elution (typically 20-250 mM)
Buffer optimization to maintain protein stability
Secondary purification steps:
Size exclusion chromatography to remove aggregates and ensure homogeneity
Ion exchange chromatography for further purification if needed
Quality control assessments:
For membrane-associated proteins, detergent selection is crucial during purification. Common detergents include DDM, LDAO, or OG, though specific recommendations for BCE_3390 were not provided in the search results.
According to the product specifications, purified BCE_3390 should be stored as follows:
Short-term storage: Working aliquots can be stored at 4°C for up to one week .
Long-term storage: Store at -20°C/-80°C upon receipt, with aliquoting necessary for multiple use .
Storage buffer: Tris/PBS-based buffer containing 6% Trehalose, pH 8.0 .
Reconstitution: The lyophilized protein should be reconstituted in deionized sterile water to a concentration of 0.1-1.0 mg/mL .
Glycerol addition: It is recommended to add 5-50% glycerol (final concentration) before aliquoting for long-term storage, with 50% being the default recommendation .
Important note: Repeated freezing and thawing should be avoided as it can lead to protein denaturation and loss of activity .
Since BCE_3390 belongs to the UPF0316 family of uncharacterized proteins, multiple complementary approaches are necessary to elucidate its function:
Comparative genomics:
Analysis of gene neighborhood and conservation across related species
Identification of co-evolved proteins that might function in the same pathway
Phylogenetic analysis to identify functional relationships with characterized proteins
Protein interaction studies:
Pull-down assays using tagged BCE_3390
Bacterial two-hybrid systems
Cross-linking coupled with mass spectrometry
Co-immunoprecipitation with potential interacting partners
Gene knockout/knockdown studies:
CRISPR-Cas9 or homologous recombination for gene disruption
Analysis of phenotypic changes in knockout strains
Complementation studies to confirm specificity of observed phenotypes
Transcriptomics/proteomics:
RNA-Seq to identify genes co-regulated with BCE_3390
Proteomics to identify changes in protein abundance in response to BCE_3390 manipulation
Structural biology approaches:
X-ray crystallography or NMR to determine 3D structure
Molecular dynamics simulations to predict functional sites
While direct evidence linking BCE_3390 to B. cereus virulence is not provided in the search results, researchers should consider potential connections based on what is known about B. cereus pathogenicity:
Relationship to toxin production:
Potential roles in spore formation or germination:
Membrane localization significance:
The amino acid sequence suggests membrane association
Membrane proteins often function in sensing environmental signals or transporting molecules
Examine if BCE_3390 participates in environmental sensing related to virulence activation
Comparative studies with clinical isolates:
For comprehensive bioinformatic analysis of BCE_3390, researchers should utilize:
Sequence analysis tools:
BLAST for identifying homologous proteins
HMMER for domain identification and classification
Multiple sequence alignments (MUSCLE, Clustal Omega) to identify conserved residues
SignalP for signal peptide prediction
TMHMM or TOPCONS for transmembrane domain prediction
Structural prediction tools:
AlphaFold or RoseTTAFold for 3D structure prediction
ConSurf for mapping evolutionary conservation onto structural models
FTMap for functional site prediction
Molecular dynamics simulations to understand dynamics and potential conformational changes
Genomic context analysis:
Functional prediction methods:
Researchers working with BCE_3390 should anticipate several challenges:
Protein solubility and stability issues:
The hydrophobic regions in BCE_3390 may lead to aggregation or inclusion body formation
Optimization of expression conditions, buffer components, and additives may be necessary
Detergent screening might be required if the protein has membrane-spanning domains
Functional characterization difficulties:
As an uncharacterized UPF0316 family protein, there may be limited reference information
The absence of clear homologs with known functions complicates prediction of activity
Developing appropriate functional assays may require trial and error
Structural analysis challenges:
Membrane proteins are notoriously difficult to crystallize
NMR studies may be complicated by size limitations and detergent micelles
Cryo-EM might be an alternative but requires sufficient size (typically >100 kDa)
Biological relevance assessment:
Connecting in vitro findings to in vivo function requires careful validation
The protein may have different roles under various environmental conditions
Expression levels may vary during different growth phases or stress conditions
To investigate protein-protein interactions involving BCE_3390:
Affinity purification-mass spectrometry (AP-MS):
Use His-tagged BCE_3390 as bait to identify interacting proteins
Cross-linking prior to lysis can capture transient interactions
Label-free quantification or SILAC can provide quantitative interaction data
Bacterial two-hybrid assays:
Adapt yeast two-hybrid systems for bacterial proteins
Screen against B. cereus genomic libraries to identify interactions
Validate positive interactions with reciprocal tests
Co-immunoprecipitation:
Generate specific antibodies against BCE_3390 or use anti-His antibodies
Perform pull-downs from native B. cereus lysates
Western blotting or mass spectrometry to identify co-precipitated proteins
Surface plasmon resonance (SPR) or isothermal titration calorimetry (ITC):
Quantify binding affinities with purified candidate interacting proteins
Determine thermodynamic parameters of interactions
Map interaction domains through mutagenesis
Proximity-based labeling methods:
BioID or APEX2 fusions to BCE_3390 expressed in B. cereus
Identification of proximal proteins through biotinylation and streptavidin pull-down
Particularly useful for membrane proteins or transient interactions
Though not explicitly described in the search results, bacterial UPF proteins often play roles in stress responses. Researchers might investigate:
Expression analysis under different stress conditions:
Heat shock, cold shock, osmotic stress, nutrient limitation
Acid stress (relevant for gastrointestinal survival)
Oxidative stress (relevant for host-pathogen interactions)
qPCR or RNA-Seq to quantify changes in BCE_3390 expression
Phenotypic characterization of BCE_3390 mutants:
Growth curves under various stress conditions
Survival rates after exposure to environmental stresses
Biofilm formation capacity
Sporulation efficiency and germination rates
Localization studies during stress responses:
Fluorescently tagged BCE_3390 to track localization changes
Membrane fractionation and Western blotting
Immuno-electron microscopy for high-resolution localization
Comparative analysis across B. cereus strains:
Correlation between BCE_3390 sequence variants and environmental adaptations
Expression patterns in strains isolated from different ecological niches
Potential horizontal gene transfer events involving this gene
For rigorous experimental design when studying BCE_3390:
Negative controls:
Empty vector controls for expression studies
Inactive mutant versions of BCE_3390 (e.g., predicted active site mutations)
Non-specific protein of similar size/properties for interaction studies
B. cereus knockout strains complemented with vector-only
Positive controls:
Well-characterized proteins from the same family (if available)
Known interaction partners for binding studies
Reference genes/proteins for expression analyses
Validation controls:
Multiple methodologies to confirm the same finding
Reciprocal tagging strategies for interaction studies
Complementation of knockout phenotypes with wild-type BCE_3390
Technical considerations:
Biological replicates (minimum n=3) for all experiments
Technical replicates for measurements with high variability
Time-course analyses rather than single time points
Dose-response relationships where applicable
Strategic mutagenesis can provide insights into structure-function relationships:
Site-directed mutagenesis targets:
Conserved residues identified through multiple sequence alignments
Predicted functional domains or motifs
Charged residues potentially involved in interactions
Transmembrane regions to assess membrane localization requirements
Mutagenesis strategies:
Alanine scanning of conserved regions
Conservative vs. non-conservative substitutions
Domain swapping with homologous proteins
Truncation mutants to identify minimal functional domains
Functional assessment of mutants:
Protein stability and folding verification
Subcellular localization comparison to wild-type
Activity assays (once established for wild-type)
Interaction studies with known partners
In vivo validation:
Complementation of knockout phenotypes with mutant variants
Competition assays between wild-type and mutant strains
Fitness measurements under various conditions
Given B. cereus' ability to form spores and the importance of spore proteins in survival and pathogenicity :
Localization studies:
Immuno-gold electron microscopy to localize BCE_3390 in spores
Fractionation of spore components (core, cortex, membranes)
Fluorescent protein fusions to track BCE_3390 during sporulation and germination
Expression analysis:
Temporal expression during sporulation phases
Comparison between vegetative cells and spores
Regulation by sporulation-specific sigma factors
Functional studies:
Interaction studies:
Co-localization with known spore proteins
Pull-down experiments from sporulating cultures
Two-hybrid screening against spore-specific proteins