Recombinant Bacillus cereus UPF0316 protein BCE_3390 (BCE_3390)

Shipped with Ice Packs
In Stock

Description

General Information

Recombinant Bacillus cereus UPF0316 protein BCE_3390 (BCE_3390) is a protein that, when expressed in E. coli, is fused to an N-terminal His tag . It is associated with the gene BCE_3390 and is also known as UPF0316 protein BCE_3390 . The protein is available as a lyophilized powder with a purity greater than 90% as determined by SDS-PAGE .

Table: Recombinant Bacillus cereus UPF0316 Protein BCE_3390 (BCE_3390) Details

FeatureDescription
Cat.No.RFL2676BF
SpeciesBacillus cereus
SourceE. coli
TagHis
Protein LengthFull Length (1-182 aa)
FormLyophilized powder
AA SequenceMLQALLIFVLQIIYVPILTIRTILLVKNQTRSAAGVGLLEGAIYIVSLGIVFQDLSNWMN IVAYVIGFSAGLLLGGYIENKLAIGYITYQVSLLDRCNELVDELRHSGFGVTVFEGEGIN SIRYRLDIVAKRSREKELLEIINEIAPKAFMSSYEIRSFKGGYLTKAMKKRALMKKKDEH AS
PurityGreater than 90% as determined by SDS-PAGE
StorageStore at -20°C/-80°C upon receipt, aliquoting is necessary for multiple use. Avoid repeated freeze-thaw cycles.
Storage BufferTris/PBS-based buffer, 6% Trehalose, pH 8.0
ReconstitutionReconstitute in deionized sterile water to a concentration of 0.1-1.0 mg/mL. Add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃.
Gene NameBCE_3390
SynonymsBCE_3390; UPF0316 protein BCE_3390
UniProt IDP61546

Role in Bacillus cereus

Bacillus cereus is a bacterium commonly found in various environments, including soil, vegetation, and food . It is known for producing toxins that can cause food poisoning . Bacillus cereus utilizes various proteins and mechanisms to adapt to its environment and compete with other microorganisms . Research has identified proteins involved in glucose catabolism, stress response, and multidrug resistance in Bacillus cereus .

Research Findings

  • EntD Protein: Proteomic analysis of Bacillus cereus has identified EntD as a novel exoprotein involved in glucose catabolism . Disruption of entD impacts glucose catabolism in an oxygen-independent manner .

  • BC3310 Efflux Pump: BC3310, a multidrug efflux pump in Bacillus cereus, confers resistance to ethidium bromide, SDS, and silver nitrate . It is part of the "unknown major facilitator family-2" (UMF-2) .

  • Certhrax Toxin: Bacillus cereus strain G9241 expresses the Certhrax toxin, which ADP-ribosylates vinculin, disrupting actin cytoskeleton interactions .

  • ComK Proteins: Research suggests that the regulation of gene expression by ComK proteins in B. cereus differs significantly from that known in B. subtilis .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for fulfillment based on your requirements.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: Our proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default glycerol concentration is 50% and may serve as a reference.
Shelf Life
Shelf life depends on several factors: storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you require a specific tag type, please inform us, and we will prioritize its development.
Synonyms
BCE_3390; UPF0316 protein BCE_3390
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-182
Protein Length
full length protein
Species
Bacillus cereus (strain ATCC 10987 / NRS 248)
Target Names
BCE_3390
Target Protein Sequence
MLQALLIFVLQIIYVPILTIRTILLVKNQTRSAAGVGLLEGAIYIVSLGIVFQDLSNWMN IVAYVIGFSAGLLLGGYIENKLAIGYITYQVSLLDRCNELVDELRHSGFGVTVFEGEGIN SIRYRLDIVAKRSREKELLEIINEIAPKAFMSSYEIRSFKGGYLTKAMKKRALMKKKDEH AS
Uniprot No.

Target Background

Database Links

KEGG: bca:BCE_3390

Protein Families
UPF0316 family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is BCE_3390 and what is known about its classification?

BCE_3390 is a protein belonging to the UPF0316 family found in Bacillus cereus. It is a full-length protein consisting of 182 amino acids (1-182aa) and has been assigned the UniProt ID P61546 . The UPF (Uncharacterized Protein Family) designation indicates that while the protein has been identified and sequenced, its precise biological function remains incompletely characterized. The protein belongs to B. cereus, a Gram-positive, facultatively anaerobic bacterium that forms endospores and is known for causing foodborne illnesses .

What is the amino acid sequence of BCE_3390?

The complete amino acid sequence of BCE_3390 has been determined and consists of 182 amino acids. The sequence is as follows:

MLQALLIFVLQIIYVPILTIRTILLVKNQTRSAAGVGLLEGAIYIVSLGIVFQDLSNWMNIVAYVIGFSAGLLLGGYIENKLAIGYITYQVSLLDRCNELVDELRHSGFGVTVFEGEGINSIRYRLDIVAKREREKELLEIINEIAPKAFMSSYEIRSFKGGYLTKAMKKRALMKKKDEHAS

Analysis of this sequence suggests several hydrophobic regions, which may indicate membrane-spanning domains. The presence of charged residues at specific positions might be important for protein-protein interactions or functional activities.

What structural characteristics can be inferred from BCE_3390's sequence?

Based on the amino acid sequence, BCE_3390 appears to have several hydrophobic regions, particularly at the N-terminus (MLQALLIFVLQIIYVPILTIRTILLVKN), suggesting possible membrane association or transmembrane domains. The protein contains multiple charged residues (such as arginine, lysine, and glutamic acid) distributed throughout its sequence, which may be involved in electrostatic interactions with other proteins or nucleic acids.

The presence of glycine residues at specific positions may provide flexibility to certain regions of the protein. Secondary structure prediction algorithms would likely identify alpha-helical regions due to the distribution of hydrophobic residues. While the search results don't explicitly describe the 3D structure, proteins in the UPF0316 family typically share conserved structural motifs that might provide clues about BCE_3390's function.

How is BCE_3390 related to B. cereus pathogenicity?

While the direct role of BCE_3390 in B. cereus pathogenicity is not explicitly described in the search results, B. cereus is known to cause foodborne illnesses characterized by two types of syndromes: an emetic (vomiting) syndrome and a diarrheal syndrome . The pathogenicity of B. cereus involves various virulence factors, including the emetic toxin synthetase gene cluster (ces gene cluster) and diarrheal toxins .

Researchers investigating BCE_3390 should consider potential relationships between this protein and known virulence mechanisms. B. cereus strains isolated from foodborne outbreaks have been found to contain numerous virulence factors, including complete ces gene clusters that encode emetic toxins synthesized via the NRPS (Non-Ribosomal Peptide Synthetase) system . Further research is needed to determine if BCE_3390 interacts with any of these pathogenicity pathways.

What are the optimal expression systems for producing recombinant BCE_3390?

Based on the available information, recombinant BCE_3390 has been successfully expressed in E. coli expression systems . This approach is common for bacterial proteins due to its efficiency and scalability. For optimal expression:

  • Vector selection: pET-based vectors with T7 promoters are frequently used for high-level expression.

  • E. coli strain: BL21(DE3) or derivatives are recommended due to their protease deficiency.

  • Induction conditions: IPTG concentration (typically 0.1-1.0 mM), temperature (16-37°C), and duration (3-16 hours) should be optimized.

  • Growth media: Rich media (LB) for standard expression, or minimal media for isotope labeling in structural studies.

For membrane-associated proteins like BCE_3390 (which appears to have hydrophobic regions), specialized approaches may be necessary:

  • Lower induction temperatures (16-25°C) to reduce inclusion body formation

  • Addition of solubilizing agents or detergents

  • Consideration of cell-free expression systems for highly hydrophobic proteins

Alternative expression systems (yeast, insect cells) could be explored if E. coli expression yields insufficient soluble protein, though these were not mentioned in the search results.

What purification strategies are most effective for BCE_3390?

The search results indicate that BCE_3390 has been produced with an N-terminal His tag , which facilitates purification by immobilized metal affinity chromatography (IMAC). A comprehensive purification strategy would include:

  • Initial IMAC purification:

    • Ni-NTA or Co-based resins

    • Imidazole gradient elution (typically 20-250 mM)

    • Buffer optimization to maintain protein stability

  • Secondary purification steps:

    • Size exclusion chromatography to remove aggregates and ensure homogeneity

    • Ion exchange chromatography for further purification if needed

  • Quality control assessments:

    • SDS-PAGE to confirm >90% purity as reported

    • Mass spectrometry to verify protein identity

    • Dynamic light scattering to assess homogeneity

For membrane-associated proteins, detergent selection is crucial during purification. Common detergents include DDM, LDAO, or OG, though specific recommendations for BCE_3390 were not provided in the search results.

What are the recommended storage conditions for purified BCE_3390?

According to the product specifications, purified BCE_3390 should be stored as follows:

  • Short-term storage: Working aliquots can be stored at 4°C for up to one week .

  • Long-term storage: Store at -20°C/-80°C upon receipt, with aliquoting necessary for multiple use .

  • Storage buffer: Tris/PBS-based buffer containing 6% Trehalose, pH 8.0 .

  • Reconstitution: The lyophilized protein should be reconstituted in deionized sterile water to a concentration of 0.1-1.0 mg/mL .

  • Glycerol addition: It is recommended to add 5-50% glycerol (final concentration) before aliquoting for long-term storage, with 50% being the default recommendation .

Important note: Repeated freezing and thawing should be avoided as it can lead to protein denaturation and loss of activity .

What experimental approaches are recommended for determining BCE_3390's function?

Since BCE_3390 belongs to the UPF0316 family of uncharacterized proteins, multiple complementary approaches are necessary to elucidate its function:

  • Comparative genomics:

    • Analysis of gene neighborhood and conservation across related species

    • Identification of co-evolved proteins that might function in the same pathway

    • Phylogenetic analysis to identify functional relationships with characterized proteins

  • Protein interaction studies:

    • Pull-down assays using tagged BCE_3390

    • Bacterial two-hybrid systems

    • Cross-linking coupled with mass spectrometry

    • Co-immunoprecipitation with potential interacting partners

  • Gene knockout/knockdown studies:

    • CRISPR-Cas9 or homologous recombination for gene disruption

    • Analysis of phenotypic changes in knockout strains

    • Complementation studies to confirm specificity of observed phenotypes

  • Transcriptomics/proteomics:

    • RNA-Seq to identify genes co-regulated with BCE_3390

    • Proteomics to identify changes in protein abundance in response to BCE_3390 manipulation

  • Structural biology approaches:

    • X-ray crystallography or NMR to determine 3D structure

    • Molecular dynamics simulations to predict functional sites

How might BCE_3390 relate to B. cereus virulence and pathogenicity mechanisms?

While direct evidence linking BCE_3390 to B. cereus virulence is not provided in the search results, researchers should consider potential connections based on what is known about B. cereus pathogenicity:

  • Relationship to toxin production:

    • B. cereus produces both emetic and diarrheal toxins

    • The ces gene cluster encodes emetic toxin synthetase

    • Investigate possible roles of BCE_3390 in toxin synthesis, regulation, or secretion

  • Potential roles in spore formation or germination:

    • B. cereus can survive in spore form for prolonged periods

    • Germination proteins in the inner membrane are critical for spore viability

    • Determine if BCE_3390 localizes to spore membranes or affects germination processes

  • Membrane localization significance:

    • The amino acid sequence suggests membrane association

    • Membrane proteins often function in sensing environmental signals or transporting molecules

    • Examine if BCE_3390 participates in environmental sensing related to virulence activation

  • Comparative studies with clinical isolates:

    • The genomic characterization of B. cereus strains from foodborne outbreaks revealed specific virulence factors

    • Compare BCE_3390 sequence and expression across virulent and non-virulent strains

What bioinformatic tools are most useful for analyzing BCE_3390?

For comprehensive bioinformatic analysis of BCE_3390, researchers should utilize:

  • Sequence analysis tools:

    • BLAST for identifying homologous proteins

    • HMMER for domain identification and classification

    • Multiple sequence alignments (MUSCLE, Clustal Omega) to identify conserved residues

    • SignalP for signal peptide prediction

    • TMHMM or TOPCONS for transmembrane domain prediction

  • Structural prediction tools:

    • AlphaFold or RoseTTAFold for 3D structure prediction

    • ConSurf for mapping evolutionary conservation onto structural models

    • FTMap for functional site prediction

    • Molecular dynamics simulations to understand dynamics and potential conformational changes

  • Genomic context analysis:

    • DOOR2 or OperonDB for operon prediction

    • STRING for protein-protein interaction network analysis

    • Analysis of genomic organization using tools like GeneMarkS which was used for gene prediction in B. cereus strains

  • Functional prediction methods:

    • InterProScan for functional domain identification

    • KEGG, TCDB, PHI databases for functional annotation

    • CAZy database for carbohydrate-active enzyme classification

What challenges might researchers face when working with BCE_3390?

Researchers working with BCE_3390 should anticipate several challenges:

  • Protein solubility and stability issues:

    • The hydrophobic regions in BCE_3390 may lead to aggregation or inclusion body formation

    • Optimization of expression conditions, buffer components, and additives may be necessary

    • Detergent screening might be required if the protein has membrane-spanning domains

  • Functional characterization difficulties:

    • As an uncharacterized UPF0316 family protein, there may be limited reference information

    • The absence of clear homologs with known functions complicates prediction of activity

    • Developing appropriate functional assays may require trial and error

  • Structural analysis challenges:

    • Membrane proteins are notoriously difficult to crystallize

    • NMR studies may be complicated by size limitations and detergent micelles

    • Cryo-EM might be an alternative but requires sufficient size (typically >100 kDa)

  • Biological relevance assessment:

    • Connecting in vitro findings to in vivo function requires careful validation

    • The protein may have different roles under various environmental conditions

    • Expression levels may vary during different growth phases or stress conditions

How can researchers investigate potential interactions between BCE_3390 and other B. cereus proteins?

To investigate protein-protein interactions involving BCE_3390:

  • Affinity purification-mass spectrometry (AP-MS):

    • Use His-tagged BCE_3390 as bait to identify interacting proteins

    • Cross-linking prior to lysis can capture transient interactions

    • Label-free quantification or SILAC can provide quantitative interaction data

  • Bacterial two-hybrid assays:

    • Adapt yeast two-hybrid systems for bacterial proteins

    • Screen against B. cereus genomic libraries to identify interactions

    • Validate positive interactions with reciprocal tests

  • Co-immunoprecipitation:

    • Generate specific antibodies against BCE_3390 or use anti-His antibodies

    • Perform pull-downs from native B. cereus lysates

    • Western blotting or mass spectrometry to identify co-precipitated proteins

  • Surface plasmon resonance (SPR) or isothermal titration calorimetry (ITC):

    • Quantify binding affinities with purified candidate interacting proteins

    • Determine thermodynamic parameters of interactions

    • Map interaction domains through mutagenesis

  • Proximity-based labeling methods:

    • BioID or APEX2 fusions to BCE_3390 expressed in B. cereus

    • Identification of proximal proteins through biotinylation and streptavidin pull-down

    • Particularly useful for membrane proteins or transient interactions

What role might BCE_3390 play in B. cereus adaptation to environmental stresses?

Though not explicitly described in the search results, bacterial UPF proteins often play roles in stress responses. Researchers might investigate:

  • Expression analysis under different stress conditions:

    • Heat shock, cold shock, osmotic stress, nutrient limitation

    • Acid stress (relevant for gastrointestinal survival)

    • Oxidative stress (relevant for host-pathogen interactions)

    • qPCR or RNA-Seq to quantify changes in BCE_3390 expression

  • Phenotypic characterization of BCE_3390 mutants:

    • Growth curves under various stress conditions

    • Survival rates after exposure to environmental stresses

    • Biofilm formation capacity

    • Sporulation efficiency and germination rates

  • Localization studies during stress responses:

    • Fluorescently tagged BCE_3390 to track localization changes

    • Membrane fractionation and Western blotting

    • Immuno-electron microscopy for high-resolution localization

  • Comparative analysis across B. cereus strains:

    • Correlation between BCE_3390 sequence variants and environmental adaptations

    • Expression patterns in strains isolated from different ecological niches

    • Potential horizontal gene transfer events involving this gene

What controls are essential when performing functional studies with BCE_3390?

For rigorous experimental design when studying BCE_3390:

  • Negative controls:

    • Empty vector controls for expression studies

    • Inactive mutant versions of BCE_3390 (e.g., predicted active site mutations)

    • Non-specific protein of similar size/properties for interaction studies

    • B. cereus knockout strains complemented with vector-only

  • Positive controls:

    • Well-characterized proteins from the same family (if available)

    • Known interaction partners for binding studies

    • Reference genes/proteins for expression analyses

  • Validation controls:

    • Multiple methodologies to confirm the same finding

    • Reciprocal tagging strategies for interaction studies

    • Complementation of knockout phenotypes with wild-type BCE_3390

  • Technical considerations:

    • Biological replicates (minimum n=3) for all experiments

    • Technical replicates for measurements with high variability

    • Time-course analyses rather than single time points

    • Dose-response relationships where applicable

How should researchers approach BCE_3390 mutagenesis studies?

Strategic mutagenesis can provide insights into structure-function relationships:

  • Site-directed mutagenesis targets:

    • Conserved residues identified through multiple sequence alignments

    • Predicted functional domains or motifs

    • Charged residues potentially involved in interactions

    • Transmembrane regions to assess membrane localization requirements

  • Mutagenesis strategies:

    • Alanine scanning of conserved regions

    • Conservative vs. non-conservative substitutions

    • Domain swapping with homologous proteins

    • Truncation mutants to identify minimal functional domains

  • Functional assessment of mutants:

    • Protein stability and folding verification

    • Subcellular localization comparison to wild-type

    • Activity assays (once established for wild-type)

    • Interaction studies with known partners

  • In vivo validation:

    • Complementation of knockout phenotypes with mutant variants

    • Competition assays between wild-type and mutant strains

    • Fitness measurements under various conditions

What approaches can be used to study BCE_3390 in the context of B. cereus spores?

Given B. cereus' ability to form spores and the importance of spore proteins in survival and pathogenicity :

  • Localization studies:

    • Immuno-gold electron microscopy to localize BCE_3390 in spores

    • Fractionation of spore components (core, cortex, membranes)

    • Fluorescent protein fusions to track BCE_3390 during sporulation and germination

  • Expression analysis:

    • Temporal expression during sporulation phases

    • Comparison between vegetative cells and spores

    • Regulation by sporulation-specific sigma factors

  • Functional studies:

    • Impact of BCE_3390 deletion on spore formation efficiency

    • Spore resistance properties (heat, chemicals, radiation)

    • Germination rates and responsiveness to germinants

    • Integration with known germination pathways involving GerR receptors

  • Interaction studies:

    • Co-localization with known spore proteins

    • Pull-down experiments from sporulating cultures

    • Two-hybrid screening against spore-specific proteins

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.