Recombinant Bacillus cereus UPF0316 protein BCE33L3064 (BCE33L3064)

Shipped with Ice Packs
In Stock

Description

General Information

Recombinant Bacillus cereus UPF0316 protein BCE33L3064 (BCE33L3064) is a protein derived from the bacterium Bacillus cereus . It belongs to the UPF0316 protein family and is also referred to as BCE33L3064 .

Characteristics

  • Source Organism Bacillus cereus (strain ZK / E33L)

  • UniProt Accession Number: Q638L6

  • Molecular Weight: The protein encoded by BC_3716 has a molecular mass of approximately 33463.9 Da .

  • Isoelectric Point: The isoelectric point is 8.93 .

  • Domains: Contains two N-terminus SH3_3 domains (PF08239) and a C-terminus putative cell wall binding domain named 3D domain (PF06725) .

  • Amino Acid Sequence: mLQALLIFVLQIIYVPILTIRTILLVKNQTRSAAAVGLLEGAIYIVS

  • Stability: Cellulase and protease expressed in B. cereus have an instability index of 26.16 and 20.18, respectively, which is much lower than the threshold of 40, indicating that both enzymes are considered stable .

Function and Role

BCE33L3064 shares similarities with exoproteins EntA, EntB, and EntC . It may function as a multidrug efflux pump conferring resistance to ethidium bromide, SDS, and silver nitrate . The high conservation of bc3310 within the B. cereus group genomes indicates that it is part of the core genome . BC3310 may not be a typical multidrug transporter, but rather an important component in the normal physiology of the bacteria, under conditions that still remain to be identified .

4.1. EntD as a Pivotal Protein

Proteogenomics identified EntD as a novel exoprotein in B. cereus ATCC 14579 . Disruption of entD significantly decreased the B. cereus growth rate and the acetate overflow without a significant change in final biomass, probably by decreasing the glucose uptake rate . The entD disruption impacts glucose catabolism in an oxygen-independent manner .

4.2. BC3310 as a Multidrug Transporter

BC3310 from Bacillus cereus ATCC 14579, a member of the “unknown major facilitator family-2” (UMF-2), was shown to be a multidrug efflux pump . A conserved aspartate residue (D105) in putative transmembrane helix 4 was identified, which was essential for the energy-dependent ethidium bromide efflux by BC3310 .

4.3. Simultaneous Expression of Cellulase and Protease

Bacillus cereus cells acquired the cellulase gene into their genome with cellulase activity of about 0.61 u.mL-1 . By scoC gene deletion, the protease activity reached 363.14 u.mL-1 from 230 u.mL-1 . The cellulase activity under the control of the protease promoter was also increased to 0.78 u.mL-1 from 0.61 u.mL-1 .

Applications

ApplicationDescription
ELISACan be used in ELISA assays .
Drug Resistance StudiesUseful in studying multidrug resistance mechanisms in bacteria .
Metabolic EngineeringCan be utilized in metabolic engineering to produce and secrete important industrial extracellular enzymes (cellulase and protease), with easy downstream purification processes .
Enzyme Activity StudiesUseful for studying cellulase and protease activities .
Growth Rate StudiesUseful for studying the impact of gene disruption on bacterial growth rate .
Glucose CatabolismUseful for studying the impact of gene disruption on glucose catabolism in an oxygen-independent manner .
Protein-Protein InteractionsContains two N-terminus SH3_3 domains known to be involved in protein-protein interactions together with a C-terminus putative cell wall binding domain, making it useful in studying protein-protein interactions and cell wall binding .

Genetic engineering

FeatureDescription
Homologous RecombinationUtilized in the deletion of scoC as one of the most important repressors of protease gene, resulting in increased protease expression. The cellulase expression, which was expressed under the control of the protease promoter region, was also increased simultaneously .
Heterologous ExpressionUsed to express BC3310 in Escherichia coli DH5α ΔacrAB, which conferred resistance to ethidium bromide, SDS, and silver nitrate .
Mutant ConstructionA ΔentD mutant was constructed by introducing a spectinomycin-resistance cassette into the corresponding gene of B. cereus strain ATCC 14579 .
Primer DesignPrimers such as BcKerF, KerUpR, kerCelF, celKerDwR, KerDwF, and BcKerR were used to amplify upstream and downstream regions of protease, cellulase gene, and scoC gene .
Screening MethodsScreening Bacillus cereus EG302 cellulase activity was done on CMC Agar plate .
qRT-PCRUsed to detect AgNO3-induced temporal expression of bc3310 .
Transcriptional Start SiteA transcriptional start site (G) located 26 bp from the translational start site (ATG) was determined by 5′PCR. Upstream of this transcriptional start site, a putative housekeeping σA type -10 sequence (5′-TATAAT-3′) and a σD type -35 sequence (5′-CTAAA-3′) were identified .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please consult your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a guideline.
Shelf Life
Shelf life depends on several factors, including storage conditions, buffer composition, temperature, and the protein's inherent stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its inclusion.
Synonyms
BCE33L3064; UPF0316 protein BCE33L3064
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-182
Protein Length
full length protein
Species
Bacillus cereus (strain ZK / E33L)
Target Names
BCE33L3064
Target Protein Sequence
MLQALLIFVLQIIYVPILTIRTILLVKNQTRSAAAVGLLEGAIYIVSLGIVFQDLSNWMN IVAYVIGFSAGLLLGGYIENKLAIGYITYQVSLLDRCNELVDELRHSGFGVTVFEGEGIN SIRYRLDIVAKRSREKELLEIINEIAPKAFMSSYEIRSFKGGYLTKAMKKRALMKKKDHH VS
Uniprot No.

Target Background

Database Links
Protein Families
UPF0316 family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is the BCE33L3064 protein and to which protein family does it belong?

BCE33L3064 is a protein from Bacillus cereus classified in the UPF0316 protein family. The UPF (Uncharacterized Protein Family) designation indicates that the precise function of this protein family remains incompletely characterized. Based on comparative analysis with other B. cereus proteins, it likely contains specific functional domains that contribute to bacterial cell physiology, similar to how EntD contains SH3_3 domains involved in protein-protein interactions and a putative cell wall binding domain . The protein is available in recombinant form as either liquid or lyophilized powder for research applications .

How can I express BCE33L3064 in bacterial expression systems?

Expression of BCE33L3064 in bacterial systems typically requires optimization of several parameters. The gene encoding BCE33L3064 should be cloned into an appropriate expression vector with a strong promoter (e.g., T7) and ideally fused with a purification tag (His-tag, GST, etc.). For optimal expression:

  • Transform the construct into an appropriate E. coli strain (BL21(DE3), Rosetta, or Arctic Express)

  • Test expression at different temperatures (16°C, 25°C, 37°C)

  • Vary IPTG concentration (0.1-1.0 mM) for induction

  • Optimize induction time (4-24 hours)

This methodology mirrors approaches used for other B. cereus proteins like EntD, where researchers used PCR amplification with specific primers and cloning into appropriate vectors . Expression conditions should be optimized to maximize protein yield while minimizing the formation of inclusion bodies.

What purification methods are most effective for BCE33L3064?

Purification of BCE33L3064 typically follows a multi-step process depending on the fusion tag used:

Purification StepMethodBuffer ConditionsExpected Results
Initial CaptureAffinity chromatography (Ni-NTA for His-tagged protein)50 mM Tris-HCl pH 8.0, 300 mM NaCl, 10-250 mM imidazole gradient70-80% purity
Intermediate PurificationIon Exchange Chromatography20 mM Tris-HCl pH 8.0, 0-1 M NaCl gradient85-90% purity
PolishingSize Exclusion Chromatography20 mM Tris-HCl pH 7.5, 150 mM NaCl>95% purity

The purification protocol should be adjusted based on the protein's theoretical pI and molecular weight, similar to the approach used when working with other B. cereus proteins . Protein purity should be confirmed by SDS-PAGE and Western blotting using antibodies against the protein or its fusion tag.

How do I confirm the identity and integrity of purified BCE33L3064?

Multiple analytical techniques should be employed to verify identity and integrity:

  • SDS-PAGE to assess purity and apparent molecular weight

  • Western blotting with anti-His (or appropriate tag) antibodies

  • Mass spectrometry (MALDI-TOF or ESI-MS) to confirm molecular mass

  • N-terminal sequencing to verify the correct start of the protein

  • Circular dichroism (CD) spectroscopy to evaluate secondary structure content

Research on EntD protein from B. cereus demonstrated the importance of proper protein identification through proteomics approaches, where multiple peptides were mapped to the corresponding gene locus to confirm protein identity . Similar rigorous identification is recommended for BCE33L3064.

What structural characteristics define BCE33L3064 and how can they be determined?

Determining the structural characteristics of BCE33L3064 requires a multi-method approach:

  • Bioinformatic prediction: Use tools like Pfam, SMART, and I-TASSER to predict domains, secondary structure, and tertiary structure based on homology to characterized proteins. Based on analysis of other B. cereus proteins, BCE33L3064 may contain specific functional domains similar to how EntD contains SH3_3 domains and cell wall binding domains .

  • Experimental structure determination:

    • X-ray crystallography: Requires protein crystallization screening, diffraction data collection, and structure solution

    • NMR spectroscopy: Suitable for proteins <30 kDa, requires isotope-labeled protein

    • Cryo-EM: Increasingly used for larger proteins or complexes

  • Limited proteolysis: Identify stable domains by digesting the protein with proteases and analyzing the resistant fragments by mass spectrometry

  • Differential scanning fluorimetry: Determine thermal stability and identify buffer conditions that enhance stability

When analyzing the structural features, researchers should pay particular attention to conserved regions within the UPF0316 family and potential functional motifs that might indicate protein-protein interaction sites or enzymatic activity centers.

How can I determine the biochemical function of BCE33L3064?

Determining the biochemical function of an uncharacterized protein like BCE33L3064 requires a systematic approach:

  • Sequence-based predictions: Use tools like InterProScan and BLAST to identify similar proteins with known functions.

  • Activity screening assays: Test for common enzymatic activities (hydrolase, transferase, etc.) using substrate libraries.

  • Protein-protein interaction studies:

    • Pull-down assays with cell lysates

    • Yeast two-hybrid screening

    • Co-immunoprecipitation followed by mass spectrometry

    • Surface plasmon resonance (SPR) with potential interacting partners

  • Structural homology: Once the structure is determined, use tools like DALI to identify structural homologs with known functions.

  • Gene neighborhood analysis: Examine genes located near BCE33L3064 in the B. cereus genome, as functionally related genes are often clustered together.

Similar approaches were used to characterize the EntD protein from B. cereus, where extensive proteomic analysis revealed its role in regulating cellular processes and virulence .

What methodologies are optimal for studying BCE33L3064 protein-protein interactions?

Protein-protein interactions (PPIs) are critical for understanding BCE33L3064's function. Multiple complementary techniques should be employed:

TechniqueAdvantagesLimitationsData Output
Co-immunoprecipitationDetects interactions in native conditionsRequires specific antibodiesQualitative identification of interacting partners
Proximity labeling (BioID, APEX)Identifies transient and stable interactions in vivoMay capture indirect interactionsMS identification of proximal proteins
Förster Resonance Energy Transfer (FRET)Real-time monitoring in living cellsRequires fluorescent protein fusionQuantitative interaction data
Surface Plasmon ResonanceProvides binding kineticsRequires purified proteinsKon, Koff, and Kd values
Isothermal Titration CalorimetryProvides thermodynamic parametersRequires purified proteinsΔH, ΔG, ΔS, and Kd values

Research on EntD from B. cereus demonstrated the importance of protein-protein interactions in regulating various cellular processes . For BCE33L3064, identifying interaction partners would provide valuable insights into its potential function in bacterial physiology.

How can I develop a gene knockout model to study BCE33L3064 function?

Creating a BCE33L3064 knockout in B. cereus requires:

  • Design of targeting construct: Create a construct with:

    • Homology arms (500-1000 bp) flanking the BCE33L3064 gene

    • A selectable marker (e.g., spectinomycin resistance cassette)

    • Verification primers outside the homology regions

  • Transformation and selection: Transform B. cereus with the construct using electroporation and select transformants on appropriate antibiotic media.

  • Verification of gene deletion: Confirm the deletion by:

    • PCR with primers flanking the targeted region

    • RT-PCR to confirm absence of BCE33L3064 mRNA

    • Proteomic analysis to confirm absence of the protein

  • Complementation: Create a complementation strain by reintroducing the BCE33L3064 gene on a plasmid to verify phenotypes are specifically due to BCE33L3064 deletion.

Similar approaches were successfully used to create and verify an EntD knockout in B. cereus, where chromosomal allele exchanges were confirmed by PCR with primers located upstream and downstream of the target region .

How should I design experiments to investigate BCE33L3064's role in B. cereus virulence?

Investigating the role of BCE33L3064 in virulence requires a multi-faceted approach:

  • Comparative virulence studies: Compare wild-type and BCE33L3064 knockout strains in:

    • Tissue culture infection models (e.g., Caco-2 cells)

    • Insect models (Galleria mellonella)

    • Murine infection models (if appropriate)

  • Toxin production analysis:

    • Quantify major virulence factors (Nhe, Hbl, CytK) using ELISA or Western blotting

    • Assess cytotoxicity of culture filtrates on appropriate cell lines

    • Measure hemolytic activity

  • Transcriptomic analysis:

    • RNA-seq to identify genes differentially expressed in the knockout

    • qRT-PCR validation of virulence gene expression

  • Physiological characterization:

    • Growth curves under various conditions

    • Microscopic observation of cell morphology

    • Assessment of motility and biofilm formation

This approach is similar to that used for EntD research, where researchers found that EntD disruption significantly altered the expression of key virulence factors and reduced cytotoxicity in cell culture models .

What proteomics approaches are most informative for studying BCE33L3064's impact on the B. cereus proteome?

Comprehensive proteomics analysis of BCE33L3064's impact should include:

  • Label-free quantitative proteomics:

    • Compare wild-type and knockout strain proteomes at different growth phases

    • Analyze both cellular proteome and exoproteome (secreted proteins)

    • Use LC-MS/MS for protein identification and quantification

  • Sample preparation optimization:

    • Use appropriate protein extraction methods for B. cereus

    • Fractionate samples to increase proteome coverage

    • Consider enrichment strategies for low-abundance proteins

  • Data analysis pipeline:

    • Use multiple search engines (e.g., Mascot, SEQUEST) for peptide identification

    • Apply stringent FDR controls

    • Use appropriate statistical methods for quantitative comparisons

  • Functional analysis:

    • Classify differentially expressed proteins by functional categories

    • Perform pathway enrichment analysis

    • Identify protein-protein interaction networks

Similar proteomic approaches with EntD mutants revealed 308 and 79 proteins regulated by EntD in the cellular proteome and exoproteome, respectively, providing insights into its role in central metabolism, cell structure, and virulence .

How can I investigate the impact of BCE33L3064 on B. cereus metabolic pathways?

To investigate BCE33L3064's impact on metabolism:

  • Metabolomics analysis:

    • Targeted metabolomics focusing on central carbon metabolism

    • Untargeted metabolomics to identify unexpected metabolic changes

    • Stable isotope labeling to track carbon flux

  • Enzymatic assays:

    • Measure activities of key metabolic enzymes

    • Compare glycolytic rates

    • Assess TCA cycle activity

  • Respirometry:

    • Measure oxygen consumption rates

    • Determine ATP production efficiency

    • Assess response to metabolic inhibitors

  • Growth characterization:

    • Growth yields on different carbon sources

    • Measurement of fermentation end-products

    • Nutrient utilization profiling

EntD research demonstrated its impact on central metabolism by showing altered abundance of glycolytic enzymes, TCA cycle components, and changes in acetate overflow metabolism . Similar approaches could reveal metabolic roles of BCE33L3064.

What are the best approaches for studying protein-cell wall interactions of BCE33L3064?

If BCE33L3064 contains putative cell wall binding domains similar to EntD , these interactions can be studied by:

  • Binding assays with purified cell wall components:

    • Peptidoglycan binding assays

    • Polysaccharide binding experiments

    • Lipoteichoic acid interaction studies

  • Fluorescence microscopy:

    • Localization studies with fluorescently-tagged BCE33L3064

    • Co-localization with known cell wall proteins

    • FRAP (Fluorescence Recovery After Photobleaching) to study dynamics

  • Electron microscopy:

    • Immunogold labeling to visualize BCE33L3064 localization

    • TEM to assess cell wall ultrastructure in knockout strains

    • Cryo-electron tomography for 3D visualization

  • Biochemical fractionation:

    • Separate membrane, cell wall, and cytoplasmic fractions

    • Quantify BCE33L3064 distribution across fractions

    • Identify proteins co-fractionating with BCE33L3064

EntD disruption was shown to affect cell morphology and wall ultrastructure in B. cereus , suggesting potential interactions with cell wall components that could also be relevant for BCE33L3064.

How should I interpret contradictory results between different experimental approaches when studying BCE33L3064?

When facing contradictory results:

  • Methodological validation:

    • Verify experimental controls worked as expected

    • Confirm reagent quality and specificity

    • Assess whether methodological limitations might explain discrepancies

  • Biological context considerations:

    • Evaluate whether growth conditions, strain background, or experimental timing might explain differences

    • Consider whether the protein might have multiple functions depending on context

    • Assess potential compensatory mechanisms

  • Integrative analysis:

    • Weigh evidence from multiple approaches

    • Prioritize direct measurements over indirect inferences

    • Develop testable models that might reconcile contradictory findings

  • Statistical reassessment:

    • Evaluate statistical power of different experiments

    • Consider whether apparent contradictions are statistically significant

    • Apply appropriate multiple testing corrections

The EntD research showed that complementation experiments sometimes yield unexpected results, as overexpression of EntD in a complemented strain did not restore the wild-type phenotype . This demonstrates the complexity of protein function studies and the need for careful interpretation.

What are common challenges in expression and purification of BCE33L3064 and how can they be addressed?

Common challenges and solutions include:

ChallengePotential CausesSolutions
Poor expression levelsCodon bias, toxicity to hostUse codon-optimized gene, reduce expression temperature, use tightly regulated promoters
Inclusion body formationRapid expression, improper foldingLower induction temperature (16-20°C), reduce IPTG concentration, co-express with chaperones
Proteolytic degradationHost proteases, unstable proteinAdd protease inhibitors, use protease-deficient strains, optimize buffer conditions
Poor solubilityHydrophobic regions, improper foldingAdd solubility tags (MBP, SUMO), optimize buffer conditions with additives
Low purity after chromatographyNon-specific binding, aggregationOptimize imidazole concentration, add detergents or reducing agents, adjust salt concentration

Similar challenges might have been encountered during work with other B. cereus proteins like EntD, requiring optimization of expression and purification conditions to obtain functional protein for analysis .

How can I determine if BCE33L3064 forms functional complexes with other proteins?

To investigate potential complex formation:

  • Native gel electrophoresis:

    • Blue native PAGE to preserve native protein complexes

    • In-gel activity assays if enzymatic function is known

    • Western blotting to identify components

  • Size exclusion chromatography:

    • Analytical SEC to determine apparent molecular weight

    • SEC-MALS (Multi-Angle Light Scattering) for absolute molecular weight

    • SEC coupled with activity assays to identify active fractions

  • Cross-linking studies:

    • Chemical cross-linking followed by mass spectrometry

    • Photo-cross-linking with modified amino acids

    • In vivo cross-linking to capture physiologically relevant interactions

  • Structural studies of complexes:

    • Cryo-EM for larger complexes

    • X-ray crystallography of co-purified complexes

    • NMR for smaller protein-protein complexes

EntD contains SH3_3 domains known to be involved in protein-protein interactions , suggesting it forms functional complexes with other proteins. Similar complex formation might be relevant for BCE33L3064 function.

What are the most promising future research directions for BCE33L3064?

Based on current understanding of B. cereus proteins and UPF0316 family members, promising research directions include:

  • Comprehensive functional characterization:

    • Determine the biochemical activity of BCE33L3064

    • Identify interaction partners and their functional significance

    • Map the regulatory networks influenced by BCE33L3064

  • Structural biology approaches:

    • Solve the high-resolution structure of BCE33L3064

    • Identify structural features that distinguish it from other UPF0316 proteins

    • Use structure-guided approaches to probe function

  • Systems biology integration:

    • Combine transcriptomics, proteomics, and metabolomics data

    • Develop predictive models of BCE33L3064's role in cellular physiology

    • Map the impact of BCE33L3064 on virulence networks

  • Translational applications:

    • Assess BCE33L3064 as a potential antimicrobial target

    • Evaluate its utility as a biomarker for B. cereus identification

    • Investigate potential biotechnological applications

Research on EntD demonstrated its important role in B. cereus virulence through effects on metabolism, cell structure, and toxin production . Similar multifaceted approaches would be valuable for BCE33L3064 characterization.

How can comparative analysis with other bacterial UPF0316 proteins enhance understanding of BCE33L3064?

Comparative analysis approaches include:

  • Phylogenetic analysis:

    • Construct phylogenetic trees of UPF0316 proteins across bacterial species

    • Identify conserved motifs and species-specific variations

    • Correlate evolutionary patterns with bacterial physiology

  • Structural comparison:

    • Compare predicted or solved structures of UPF0316 family members

    • Identify conserved structural features that might indicate function

    • Map species-specific structural variations

  • Functional complementation:

    • Test whether BCE33L3064 can complement knockout mutants of UPF0316 proteins in other species

    • Identify functionally interchangeable domains

    • Define species-specific functional adaptations

  • Genomic context analysis:

    • Compare the genomic neighborhood of UPF0316 genes across species

    • Identify conserved gene clusters that might indicate functional relationships

    • Map operon structures and regulatory elements

The EntD research demonstrated the value of comparing related proteins (EntA, EntB, EntC) to understand function and compensatory mechanisms . Similar comparative approaches would enhance understanding of BCE33L3064.

What are the implications of BCE33L3064 research for understanding B. cereus pathogenesis?

Understanding BCE33L3064's role may advance B. cereus pathogenesis research by:

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.