Recombinant Bacillus cereus UPF0316 protein BCG9842_B1857 (BCG9842_B1857)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for fulfillment.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, which may serve as a guideline.
Shelf Life
Shelf life depends on storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its inclusion.
Synonyms
BCG9842_B1857; UPF0316 protein BCG9842_B1857
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-182
Protein Length
full length protein
Species
Bacillus cereus (strain G9842)
Target Names
BCG9842_B1857
Target Protein Sequence
MLQALLIFVLQIIYVPILTIRTILLVKNQTRSAAGVGLLEGAIYIVSLGIVFQDLSNWMN IVAYVIGFSTGLLLGGYIENKLAIGYITYQVSLLDRCNELVDELRHSGFGVTVFEGEGIN SIRYRLDIVAKRSREKELLEIINKIAPKAFMSSYEIRSFKGGYLTKAMKKRALMKKKDEH AS
Uniprot No.

Target Background

Database Links
Protein Families
UPF0316 family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

How does BCG9842_B1857 relate to homologous proteins in other Bacillus species?

BCG9842_B1857 shares significant sequence homology with UPF0316 proteins from other Bacillus species, most notably:

SpeciesProteinUniProt IDLength (aa)Sequence Identity to BCG9842_B1857
B. cereus (G9842)BCG9842_B1857B7IPN4182100%
B. anthracisBAA_3454-PartialHigh (~90%)
B. thuringiensisBALH_3038A0RGF6182High (~90%)

This high conservation is particularly significant between B. cereus and B. anthracis, which are closely related evolutionarily . The gene cluster containing BCG9842_B1857 in B. cereus is highly conserved with the ba1554-ba1558 cluster in B. anthracis and the bt1364-bt1368 cluster in B. thuringiensis, indicating critical roles for these proteins in the Bacillus genus .

The study of BCG9842_B1857 from B. cereus can serve as a useful model for understanding the function of its homologs in more pathogenic species like B. anthracis, which requires higher biosafety level facilities for research .

What are the optimal expression systems for recombinant BCG9842_B1857 production?

E. coli is the most commonly used expression system for recombinant production of BCG9842_B1857. Based on established protocols for similar Bacillus proteins, the following expression strategy is recommended :

  • Gene amplification: PCR amplification of the BCG9842_B1857 gene from B. cereus genomic DNA using specific primers with appropriate restriction sites (e.g., BamHI and SalI)

  • Vector construction: Cloning into a modified pET49b vector (pET49bm) or similar expression vectors that provide N-terminal affinity tags

  • Host strain selection: For membrane proteins like BCG9842_B1857, specialized E. coli strains designed for membrane protein expression (e.g., C41(DE3) or C43(DE3)) typically yield better results than standard strains

  • Expression optimization:

ParameterOptimal ConditionEffect on Yield
IPTG Concentration0.5 mMModerate
Induction Temperature18-20°CSignificant
Induction Time16-18 hModerate
MediaTerrific BrothModerate

Lower induction temperatures (18°C) generally improve the solubility of membrane proteins like BCG9842_B1857 by slowing protein synthesis and allowing proper folding .

What purification strategies yield the highest purity and stability for BCG9842_B1857?

Purifying transmembrane proteins like BCG9842_B1857 requires specialized approaches. The following multi-step purification strategy is recommended:

  • Cell lysis and membrane protein extraction:

    • Mechanical disruption (sonication or French press)

    • Membrane fraction isolation by ultracentrifugation

    • Solubilization with appropriate detergents (e.g., n-dodecyl-β-D-maltoside (DDM) or lauryl maltose neopentyl glycol (LMNG))

  • Affinity chromatography:

    • Nickel-NTA for His-tagged proteins

    • Buffer: 50 mM Tris pH 8.0, 150 mM NaCl, 0.1% detergent, 20-250 mM imidazole gradient

    • Expected purity: 80-85%

  • Size-exclusion chromatography (SEC):

    • Critical for removing aggregates and determining oligomeric state

    • Buffer: 50 mM Tris pH 8.0, 150 mM NaCl, 0.05% detergent

    • Expected final purity: >90-95%

  • Storage considerations:

    • 50% glycerol significantly improves stability during storage

    • Store at -20°C/-80°C with aliquoting to avoid freeze-thaw cycles

    • Working aliquots can be stored at 4°C for up to one week

The addition of stabilizing agents such as glycerol and trehalose (6%) in storage buffers has been shown to significantly enhance the stability of UPF proteins from Bacillus species .

What biophysical techniques are most effective for characterizing BCG9842_B1857?

Several biophysical techniques provide valuable insights into the structure and function of BCG9842_B1857:

  • Crystallography and structural determination:

    • X-ray crystallography for high-resolution 3D structure

    • Crystallization conditions need extensive optimization for membrane proteins

    • Crystal sizes >0.1 mm are typically required for diffraction

  • Secondary structure and stability analysis:

    • Circular dichroism (CD) spectroscopy to assess secondary structure content

    • Thermal shift assays to determine protein stability and optimal buffer conditions

    • Size-exclusion chromatography coupled with multi-angle light scattering (SEC-MALS) for oligomerization state determination

  • Membrane topology studies:

    • Cysteine accessibility methods

    • Fluorescence-based approaches

    • Limited proteolysis coupled with mass spectrometry

    • Computational predictions validated experimentally

  • Functional assays:

    • Liposome reconstitution for transport studies

    • Electrophysiology for channel activity assessment

    • Binding assays for potential ligands/substrates

These methods should be used in combination to build a comprehensive understanding of BCG9842_B1857's structure-function relationship, as has been done for other UPF proteins from Bacillus species .

How can site-directed mutagenesis help elucidate functional domains of BCG9842_B1857?

Site-directed mutagenesis is a powerful approach to identify critical residues and functional domains in BCG9842_B1857:

  • Target selection strategies:

    • Conserved residues identified through multiple sequence alignment across Bacillus species

    • Predicted transmembrane domains based on hydrophobicity analysis

    • Charged residues in potential binding pockets or channel-forming regions

    • Residues conserved in UPF0316 family but not in other protein families

  • Recommended mutation approaches:

    • Alanine scanning of conserved residues

    • Conservative and non-conservative substitutions

    • Domain swapping with homologs

    • Introduction of reporter tags at different positions to study topology

  • Functional assessment methods:

    • Expression level comparison (Western blot)

    • Membrane localization (fractionation studies)

    • Stability comparison (thermal shift assays)

    • Activity assays once the function is better defined

This systematic approach has been successfully applied to other membrane proteins from Bacillus species to elucidate structure-function relationships .

How does BCG9842_B1857 potentially contribute to B. cereus pathogenicity and virulence?

While the direct role of BCG9842_B1857 in pathogenicity remains unclear, several hypotheses can be investigated:

  • Potential virulence-related functions:

    • Membrane integrity maintenance during host infection

    • Environmental sensing of host conditions

    • Stress response enabling survival in hostile environments

    • Nutrient acquisition or transport during infection

    • Biofilm formation contribution

  • Research approaches to test these hypotheses:

    • Gene knockout studies and virulence assessment in infection models

    • Transcriptomics to identify co-regulated genes during infection

    • Comparative genomics across strains with different virulence profiles

    • Protein-protein interaction studies to identify partners in virulence pathways

  • Relevance to B. cereus as a foodborne pathogen:

    • B. cereus causes food intoxications worldwide

    • Understanding conserved proteins may reveal new pathogenic mechanisms

    • BCG9842_B1857 could be involved in survival in food matrices

Genome-wide studies of B. cereus virulence factors have identified numerous proteins associated with pathogenicity, and systematic functional characterization of conserved proteins like BCG9842_B1857 will help complete our understanding of B. cereus pathogenesis .

What are the latest methodologies for studying protein-protein interactions of BCG9842_B1857?

Understanding protein-protein interactions is crucial for elucidating BCG9842_B1857's function:

  • In vitro interaction detection methods:

    • Pull-down assays using affinity-tagged BCG9842_B1857

    • Surface plasmon resonance (SPR) for interaction kinetics

    • Isothermal titration calorimetry (ITC) for thermodynamic parameters

    • Crosslinking coupled with mass spectrometry for interaction mapping

  • In vivo interaction detection approaches:

    • Bacterial two-hybrid systems

    • Co-immunoprecipitation from B. cereus lysates

    • Proximity labeling techniques (BioID, APEX)

    • Fluorescence resonance energy transfer (FRET)

  • Validation and functional assessment:

    • Reciprocal pull-downs with identified partners

    • Mutagenesis of binding interfaces

    • Co-expression studies

    • Phenotypic analysis of interaction-deficient mutants

  • Bioinformatic prediction:

    • Use of machine learning algorithms to predict potential interaction partners

    • Structural modeling of protein complexes

    • Evolutionary analysis of co-evolving residues

These approaches provide complementary information that can help build a comprehensive interactome for BCG9842_B1857.

How do UPF0316 proteins vary across different Bacillus species, and what does this tell us about their evolution?

Comparative analysis of UPF0316 proteins across Bacillus species provides valuable evolutionary insights:

  • Sequence conservation patterns:

    • The core transmembrane domains show highest conservation

    • N- and C-terminal regions display more variability

    • Key charged residues are typically conserved across species

    • Sequence identity between B. cereus BCG9842_B1857 and B. anthracis BAA_3454 is approximately 90%

  • Evolutionary implications:

    • High conservation suggests essential cellular functions

    • Conservation across pathogenic and non-pathogenic species indicates roles beyond virulence

    • Gene cluster conservation (BCG9842_B1857 in B. cereus, ba1554 in B. anthracis, BALH_3038 in B. thuringiensis) suggests functional linkage with neighboring genes

  • Research applications:

    • Using less pathogenic B. cereus as model for studying B. anthracis proteins

    • Identifying species-specific variations that might reflect niche adaptation

    • Understanding evolutionary pressure on membrane proteins in Bacillus species

The significant homology between these proteins makes B. cereus BCG9842_B1857 an excellent model for studying the more pathogenic B. anthracis homolog without the biosafety level 3 (BSL-3) requirements .

How can structural insights from related UPF proteins inform our understanding of BCG9842_B1857?

Structural information from related UPF proteins can provide valuable insights into BCG9842_B1857:

  • Cross-family structural comparisons:

    • UPF0042 and UPF0234 proteins from Bacillus species have been better characterized

    • Common structural motifs may suggest functional similarities

    • Differences in structural elements may indicate specialized functions

  • Structure prediction approaches:

    • AlphaFold or similar AI-based prediction tools

    • Threading methods using solved structures of related proteins

    • Molecular dynamics simulations to predict behavior in membranes

    • Validation of predicted structures through limited experimental data

  • Structure-guided functional hypotheses:

    • Channel or pore-forming capabilities based on hydrophobic patterns

    • Ligand binding pockets identification

    • Oligomerization interfaces prediction

    • Post-translational modification sites identification

  • Experimental validation strategies:

    • Targeted mutagenesis of predicted functional sites

    • Chimeric protein construction

    • Domain-specific antibodies or nanobodies development

    • Limited proteolysis patterns compared to predictions

By combining structural insights from related proteins with targeted experimental validation, researchers can accelerate our understanding of BCG9842_B1857 function.

How can CRISPR-Cas9 genome editing facilitate functional studies of BCG9842_B1857?

CRISPR-Cas9 technology offers powerful approaches for studying BCG9842_B1857 function:

  • Gene knockout strategies:

    • Complete deletion to assess essentiality

    • Conditional knockouts if the gene is essential

    • Scarless genomic modifications

    • Multiplexed editing to target redundant genes simultaneously

  • Precise genomic modifications:

    • Introduction of point mutations to test specific hypotheses

    • Insertion of reporter tags for localization studies

    • Promoter replacements to control expression levels

    • Introduction of regulated degradation systems

  • High-throughput functional genomics:

    • CRISPR interference (CRISPRi) for tunable repression

    • CRISPR activation (CRISPRa) for overexpression

    • Saturating mutagenesis across the gene

    • Genetic interaction mapping through double knockouts

  • Implementation considerations for Bacillus cereus:

    • Optimized Cas9 expression for Gram-positive bacteria

    • Efficient delivery methods (electroporation or conjugation)

    • Appropriate selection markers

    • Temperature-sensitive plasmids for transient expression

CRISPR-based approaches allow unprecedented precision in genetic manipulation, enabling detailed functional characterization of BCG9842_B1857 in its native context.

What are the latest mass spectrometry approaches for characterizing membrane proteins like BCG9842_B1857?

Advanced mass spectrometry techniques offer powerful tools for membrane protein characterization:

  • Native mass spectrometry:

    • Analysis of intact membrane protein complexes

    • Determination of oligomeric states

    • Characterization of non-covalent interactions

    • Detection of bound lipids or ligands

  • Hydrogen-deuterium exchange mass spectrometry (HDX-MS):

    • Probing solvent accessibility and dynamics

    • Identifying conformational changes upon ligand binding

    • Mapping interaction interfaces

    • Detecting structural flexibility

  • Cross-linking mass spectrometry (XL-MS):

    • Capturing spatial relationships between residues

    • Validating structural models

    • Identifying interaction partners

    • Elucidating complex topologies

  • Targeted proteomics:

    • Precise quantification using selected reaction monitoring (SRM)

    • Absolute quantification with synthetic peptide standards

    • Analysis of post-translational modifications

    • Detection of low-abundance proteoforms

  • Sample preparation considerations:

    • Specialized detergents compatible with MS

    • Nanodiscs or amphipols as alternatives to detergents

    • Optimized digestion protocols for hydrophobic peptides

    • Enrichment strategies for post-translational modifications

These advanced MS approaches provide complementary structural and functional information that can significantly accelerate our understanding of challenging membrane proteins like BCG9842_B1857.

What are common challenges in BCG9842_B1857 expression and how can they be overcome?

Researchers frequently encounter several challenges when working with BCG9842_B1857:

  • Low expression levels:

    • Solution: Optimize codon usage for E. coli, test different promoters, and use specialized strains like C41(DE3) designed for membrane proteins

    • Method: Compare expression across multiple constructs with different fusion tags (His, GST, MBP) and evaluate expression using Western blotting

  • Protein aggregation:

    • Solution: Lower induction temperature (16-18°C), reduce IPTG concentration, and add solubilizing agents like arginine

    • Method: Monitor soluble vs. insoluble fractions during expression optimization

  • Proteolytic degradation:

    • Solution: Add protease inhibitors during purification, use protease-deficient expression strains, and optimize buffer composition

    • Method: Analyze stability through time-course experiments with SDS-PAGE

  • Poor membrane extraction:

    • Solution: Screen multiple detergents (DDM, LMNG, CHAPS) at various concentrations

    • Method: Systematically test extraction efficiency through quantitative Western blot analysis of solubilized vs. remaining membrane fractions

  • Low purification yield:

    • Solution: Optimize each purification step independently, minimize sample handling, and maintain cold temperatures throughout

    • Method: Track protein quantity and quality at each step using protein assays and SDS-PAGE

Success in expression and purification often requires iterative optimization of multiple parameters simultaneously.

How can researchers troubleshoot crystallization problems with BCG9842_B1857?

Crystallization of membrane proteins like BCG9842_B1857 is challenging but can be approached systematically:

  • Initial screening strategies:

    • Use specialized membrane protein crystallization screens

    • Try both vapor diffusion and lipidic cubic phase methods

    • Screen multiple detergents and detergent concentrations

    • Test various protein concentrations (5-15 mg/mL)

  • Construct optimization:

    • Remove flexible termini based on limited proteolysis

    • Create fusion proteins with crystallization chaperones (T4 lysozyme, BRIL)

    • Generate antibody fragments or nanobodies to stabilize specific conformations

    • Try homologs from thermophilic organisms

  • Crystal optimization approaches:

    • Fine-tune precipitant concentration and pH

    • Implement microseeding techniques

    • Add specific lipids or ligands

    • Adjust crystallization temperature

  • Dealing with common issues:

    • Problem: Phase separation
      Solution: Adjust detergent concentration or try different detergent types

    • Problem: Microcrystals
      Solution: Implement seeding, slow down crystal growth with lower temperatures

    • Problem: Poor diffraction
      Solution: Post-crystallization treatments, dehydration, or crystal annealing

  • Alternative approaches:

    • Cryo-electron microscopy for structure determination without crystals

    • Nuclear magnetic resonance for structural elements in solution

    • Small-angle X-ray scattering for low-resolution envelope structures

Successful crystallization typically requires testing hundreds of conditions and multiple protein constructs.

What strategies can improve the solubility and stability of recombinant BCG9842_B1857?

Improving solubility and stability of BCG9842_B1857 requires multi-faceted approaches:

  • Buffer optimization:

    • Systematic screening of pH (range 6.0-9.0)

    • Testing various salt types (NaCl, KCl) and concentrations (100-500 mM)

    • Addition of stabilizing agents (glycerol 5-20%, trehalose 5-10%)

    • Incorporation of specific lipids or lipid-like molecules

  • Fusion partners and tags:

    • Solubility-enhancing fusion partners (MBP, SUMO)

    • Stabilizing tags that can be removed post-purification

    • Optimization of linker length between the protein and fusion partner

    • Testing tag position (N-terminal vs. C-terminal)

  • Protein engineering approaches:

    • Surface entropy reduction through mutation of flexible loops

    • Substitution of exposed hydrophobic residues

    • Introduction of disulfide bridges for stability

    • Removal of proteolytically sensitive regions

  • Storage and handling considerations:

    • Optimal glycerol concentration (typically 50%)

    • Flash freezing in liquid nitrogen vs. slow freezing

    • Addition of reducing agents for proteins with cysteines

    • Aliquoting to avoid freeze-thaw cycles

  • Empirical stability testing:

    • Thermal shift assays to assess stability in different conditions

    • Size-exclusion chromatography to monitor aggregation over time

    • Activity assays to correlate stability with function

    • Light scattering techniques to detect early aggregation events

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.