Recombinant Bacillus cereus UPF0316 protein BCQ_3166 (BCQ_3166)

What is BCQ_3166 protein and where is it found in Bacillus cereus?

BCQ_3166 is a UPF0316 family protein consisting of 182 amino acids found in Bacillus cereus. The protein has a UniProt ID of B9ISM3 and is characterized by its predominantly hydrophobic amino acid sequence, suggesting it may be a membrane-associated protein . Based on sequence analysis, the protein appears to have several transmembrane domains, particularly evident in the N-terminal region of the protein where several hydrophobic amino acid stretches form potential membrane-spanning regions .

How can recombinant BCQ_3166 protein be produced in the laboratory?

Recombinant BCQ_3166 protein can be efficiently produced using heterologous expression in Escherichia coli. The full-length protein (amino acids 1-182) is typically expressed with an N-terminal histidine tag to facilitate purification . For optimal expression, the BCQ_3166 gene should be codon-optimized for E. coli expression systems. After expression, the protein can be purified using nickel affinity chromatography, taking advantage of the His-tag. The purified protein is typically supplied as a lyophilized powder with purity greater than 90% as determined by SDS-PAGE analysis .

What are the optimal storage conditions for recombinant BCQ_3166 protein?

For long-term storage, recombinant BCQ_3166 protein should be kept at -20°C to -80°C, with aliquoting necessary to avoid repeated freeze-thaw cycles that can compromise protein integrity . When preparing the protein for storage:

• Store the lyophilized powder at -20°C/-80°C upon receipt

• Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL

• Add glycerol to a final concentration of 5-50% (50% is recommended as standard)

• Aliquot into smaller volumes to avoid repeated freeze-thaw cycles

• For short-term use, working aliquots can be stored at 4°C for up to one week

The reconstitution buffer typically consists of a Tris/PBS-based buffer with 6% Trehalose at pH 8.0, which helps maintain protein stability .

What experimental approaches are recommended for studying the membrane topology of BCQ_3166?

To investigate the membrane topology of BCQ_3166, researchers should employ multiple complementary approaches:

Computational prediction methods:

• Use transmembrane prediction algorithms (TMHMM, Phobius, HMMTOP)

• Apply topology prediction software that integrates multiple algorithms

• Perform hydrophobicity plots analysis

Experimental verification methods:

• Cysteine scanning mutagenesis with membrane-impermeable thiol-reactive reagents

• Protease protection assays with recombinant protein in reconstituted membrane systems

• Fluorescence resonance energy transfer (FRET) analysis using strategically placed fluorophores

Based on the amino acid sequence, BCQ_3166 likely contains multiple transmembrane domains, with the N-terminal region (amino acids 1-50) showing particularly high hydrophobicity that suggests membrane insertion .

How can CRISPR/Cas9 genome engineering be applied to study BCQ_3166 function in Bacillus cereus?

CRISPR/Cas9 genome engineering provides a powerful approach for studying BCQ_3166 function through gene knockout, point mutations, or tagging. The protocol involves the following methodological steps:

• Design sgRNA targeting the BCQ_3166 gene with appropriate protospacer adjacent motif (PAM) sites

• Create a plasmid containing Cas9, sgRNA, and donor DNA with homologous arms flanking the target site

• Transform the plasmid into B. cereus using electroporation

• Select transformants on medium with appropriate antibiotics (typically kanamycin at 25 μg/ml)

• Induce Cas9 expression using mannose (0.4% final concentration)

• Screen for successful mutants using PCR and DNA sequencing

For optimal results in B. cereus, researchers should prepare competent cells by growing bacteria in brain heart infusion broth supplemented with 0.5% glycerol (BHIG) and perform electroporation under specific conditions (typically 25 μF, 200 Ω, 2.5 kV) . This technique has shown high efficiency in B. cereus, with successful point mutations achieving up to 100% modification rates in small genomic regions .

What methods are recommended for investigating protein-protein interactions involving BCQ_3166?

For investigating protein-protein interactions involving BCQ_3166, researchers should consider these methodological approaches:

In vitro methods:

• Pull-down assays using His-tagged BCQ_3166 as bait

• Surface plasmon resonance (SPR) for kinetic analysis of binding

• Isothermal titration calorimetry (ITC) for thermodynamic parameters

In vivo methods:

• Bacterial two-hybrid system adapted for Bacillus species

• Proximity-dependent biotin identification (BioID)

• Co-immunoprecipitation followed by mass spectrometry

Cross-linking approaches:

• Chemical cross-linking with membrane-permeable reagents

• Photo-cross-linking with modified amino acids incorporated into BCQ_3166

When designing these experiments, researchers should account for BCQ_3166's membrane association by using appropriate detergents (such as n-dodecyl β-D-maltoside or digitonin) for extraction while maintaining native protein interactions .

How does the structure-function relationship of BCQ_3166 compare with other UPF0316 family proteins?

The structure-function relationship of BCQ_3166 can be analyzed in comparison to other UPF0316 family proteins through multiple approaches:

• Sequence alignment analysis: Multiple sequence alignment of BCQ_3166 with UPF0316 proteins from related species reveals conserved domains, particularly in the transmembrane regions. The amino acid sequence of BCQ_3166 (MLQALLIFVLQIIYVPILTIRTILLVKNQTRSAAAVGLLEGAIYIVSLGIVFQDLSNWMNIVAYVIGFSAGLLLGGYIENKLAIGYITYQVSLLDRCNELVDELRHSGFGVTVFEGEGINS IRYRLDIVAKRSREKELLEIINEIAPKAFMSSYEIRSFKGGYLTKAMKKRALMKKKDHHAS) shows distinctive hydrophobic N-terminal regions that are characteristic of this protein family .

• Structural prediction: Homology modeling and ab initio structure prediction methods suggest that BCQ_3166 likely forms multiple membrane-spanning α-helices with connecting loops that may participate in protein-protein interactions or substrate binding.

• Functional domain analysis: Conserved domains in the C-terminal region (amino acids 120-170) suggest potential roles in signaling or regulatory functions, particularly through the SIRYRLDI motif found in the sequence .

For experimental validation of structure-function relationships, site-directed mutagenesis targeting conserved residues followed by functional assays would provide critical insights into this poorly characterized protein family.

What are the challenges in purifying and crystallizing membrane-associated proteins like BCQ_3166?

Purifying and crystallizing membrane-associated proteins like BCQ_3166 presents several methodological challenges:

Purification challenges:

• Maintaining protein stability during solubilization from membranes

• Selecting appropriate detergents that preserve native conformation

• Preventing protein aggregation during concentration steps

Crystallization challenges:

• Detergent micelle interference with crystal contacts

• Inherent conformational flexibility of membrane proteins

• Low expression yields limiting material availability

Recommended approaches for BCQ_3166 include lipid cubic phase crystallization or the use of newer technologies such as single-particle cryo-electron microscopy, which has revolutionized membrane protein structure determination by eliminating the need for crystals .

How can phenotypic changes in BCQ_3166 knockout mutants be comprehensively assessed?

Comprehensive phenotypic assessment of BCQ_3166 knockout mutants requires multi-omics approaches and functional assays:

Transcriptomic analysis:

• RNA-Seq to identify differentially expressed genes in knockout vs. wild-type strains

• RT-qPCR validation of key gene expression changes

Proteomic and metabolomic approaches:

• Quantitative proteomics using iTRAQ or TMT labeling

• Untargeted metabolomics to identify altered metabolic pathways

• Lipidomics to assess membrane composition changes

Functional phenotypic assays:

• Growth kinetics under various stress conditions (pH, temperature, osmotic stress)

• Membrane permeability assessments using fluorescent dyes

• Biofilm formation capacity evaluation

• Motility assays (if applicable to the strain)

For genotypic verification of the knockout, researchers should employ PCR-based methods similar to those described for CRISPR/Cas9 genome engineering in B. cereus, where multiple primer pairs are used to confirm successful gene modification . The absence of BCQ_3166 expression can be confirmed by Western blotting using antibodies against the native protein or by RT-qPCR to verify the absence of transcript.

What quality control measures should be implemented when working with recombinant BCQ_3166?

To ensure reproducible results when working with recombinant BCQ_3166, implement these quality control measures:

Protein purity assessment:

• SDS-PAGE analysis (>90% purity is standard)

• Size exclusion chromatography to assess aggregation state

• Mass spectrometry to confirm protein identity and detect modifications

Functional assessment:

• Circular dichroism spectroscopy to verify proper secondary structure

• Activity assays (if known function) or binding assays

• Thermal shift assays to assess protein stability

Storage stability monitoring:

• Regular testing of aliquots to assess degradation over time

• Freeze-thaw testing to determine sensitivity to temperature cycling

• Documentation of lot-to-lot variation for commercial preparations

For consistent results, maintain strict temperature control during storage (-20°C/-80°C), avoid repeated freeze-thaw cycles, and use proper reconstitution procedures with deionized sterile water and glycerol addition as previously described .

What are common challenges in CRISPR/Cas9-mediated gene editing of Bacillus cereus and how can they be addressed?

When applying CRISPR/Cas9 for BCQ_3166 gene editing in B. cereus, researchers may encounter several challenges:

Challenge 1: Low transformation efficiency

• Solution: Optimize electroporation conditions (25 μF, 200 Ω, 2.5 kV) and use brain heart infusion broth with 0.5% glycerol (BHIG) for competent cell preparation

• Recommendation: Use freshly prepared competent cells and ensure proper plasmid quality

Challenge 2: Off-target effects

• Solution: Carefully design sgRNAs with minimal off-target potential using prediction tools

• Recommendation: Sequence multiple locations with predicted off-target activity

Challenge 3: Plasmid curing difficulties

• Solution: Passage mutant strains multiple times (typically three) in the absence of antibiotics

• Recommendation: Confirm plasmid loss by testing for kanamycin susceptibility

Challenge 4: Low homologous recombination efficiency

• Solution: Ensure homology arms are at least 500-1000 bp in length

• Recommendation: The B. cereus group has inherently low homologous recombination efficiency, so optimize donor DNA concentration and Cas9 expression timing

By addressing these challenges methodically, researchers can achieve high modification rates, as demonstrated in B. anthracis, where 100% modification rates were achieved for small genomic fragments using CRISPR/Cas9 .

How might BCQ_3166 function be integrated into systems biology models of Bacillus cereus?

Integrating BCQ_3166 function into systems biology models requires:

• Contextual network analysis:

  • Integration of transcriptomic and proteomic data from BCQ_3166 mutants

  • Identification of co-expressed genes and protein interaction partners

  • Mapping BCQ_3166 to metabolic or signaling pathways

• Regulatory network modeling:

  • Identification of transcription factors regulating BCQ_3166 expression

  • Characterization of BCQ_3166's response to environmental stressors

  • Integration into existing regulatory network models for B. cereus

• Functional prediction refinement:

  • Machine learning approaches using multi-omics data

  • Evolutionary analysis across the Bacillus genus

  • Structural modeling integrated with omics data

The research pathway should begin with comprehensive phenotypic characterization of knockout mutants, followed by multi-omics data generation, and culminating in computational integration with existing B. cereus systems models. This approach could reveal unexpected functional roles for this poorly characterized protein and establish its context within bacterial physiology.

What novel applications might emerge from understanding BCQ_3166 function in Bacillus cereus pathogenesis or ecology?

Understanding BCQ_3166 function could lead to novel applications in:

Pathogenesis intervention:

• If BCQ_3166 plays a role in virulence, it could represent a new antimicrobial target

• Development of inhibitors targeting BCQ_3166 function

• Creation of attenuated B. cereus strains for vaccine development using precise CRISPR/Cas9 editing

Biotechnological applications:

• Engineered B. cereus strains with modified BCQ_3166 for industrial applications

• Development of biosensors if BCQ_3166 responds to specific environmental signals

• Improvement of heterologous protein expression systems in Bacillus species

Ecological insights:

• Understanding BCQ_3166's role in environmental adaptation

• Potential involvement in biofilm formation or persistence

• Contribution to B. cereus survival in food production environments

The CRISPR/Cas9 system described for B. cereus provides an excellent platform for precise genetic manipulation to explore these possibilities, allowing for marker-free mutations and even point mutations with high efficiency .

How does the function of BCQ_3166 in Bacillus cereus compare to homologous proteins in related pathogenic Bacillus species?

Comparative analysis of BCQ_3166 with homologous proteins in related Bacillus species reveals important functional insights:

Sequence conservation patterns:

• BCQ_3166 shares significant sequence homology with proteins in B. anthracis and B. thuringiensis

• Key conserved domains suggest shared functional roles across the B. cereus group

• Species-specific variations may relate to pathogenic differences

Functional context differences:

• In B. anthracis, homologous proteins may interact with virulence factors under PlcR regulation

• The PlcR regulator is non-functional in B. anthracis due to a nonsense mutation at position 640, forming a stop codon, which affects the expression of many genes

• B. thuringiensis homologs may have specialized functions related to insecticidal properties

Expression pattern variations:

• Differential expression under various growth conditions across species

• Potential co-regulation with species-specific virulence factors

• Response to environmental stressors may vary between species

For experimental validation of functional conservation, CRISPR/Cas9-mediated genome editing can be applied across these Bacillus species following similar protocols, as the technology has been demonstrated to work efficiently in both B. anthracis and B. cereus with modification rates approaching 100% for small genomic modifications .

What insights can be gained from studying BCQ_3166 protein interactions in different cellular compartments?

Investigating BCQ_3166 protein interactions across cellular compartments can provide comprehensive functional insights:

Membrane-associated interactions:

• Identify potential protein complexes within the membrane

• Characterize interactions with other membrane proteins

• Examine role in maintaining membrane integrity or permeability

Cytoplasmic interactions:

• Study potential interactions with cytoplasmic regulatory proteins

• Investigate associations with metabolic enzymes

• Characterize any role in signal transduction

Extracellular interactions:

• Assess potential interactions with secreted proteins

• Examine role in biofilm formation

• Investigate interactions with host factors (if pathogenesis-related)

For investigating these interactions, researchers can use tagged versions of BCQ_3166 created using the CRISPR/Cas9 genome editing system, which allows for precise modifications with high efficiency .

How can recombinant BCQ_3166 be optimized for structural studies using cryo-electron microscopy?

Optimizing recombinant BCQ_3166 for cryo-EM structural studies requires:

Expression and purification optimization:

• Screening multiple expression constructs with varying tags (His, MBP, SUMO)

• Testing different E. coli expression strains (BL21(DE3), C41/C43 for membrane proteins)

• Purification in appropriate detergents that maintain structural integrity

Sample preparation considerations:

• Detergent exchange to amphipols or nanodiscs for improved particle dispersion

• Concentration optimization to achieve 0.5-5 mg/ml without aggregation

• Grid preparation with optimal ice thickness (use Quantifoil R1.2/1.3 or UltrAuFoil grids)

Data collection parameters:

• Use of energy filters and K3/K2 direct electron detectors

• Collection of large datasets (>5000 micrographs) to ensure sufficient particles

• Implementation of motion correction and CTF estimation algorithms

For the specific case of BCQ_3166, its relatively small size (182 amino acids) presents challenges for cryo-EM, which typically works better for proteins >100 kDa. Consider using approaches such as antibody fragment complexing or reconstitution into nanodiscs to increase effective particle size and improve orientation distribution during imaging .

What considerations should guide the design of BCQ_3166 constructs for functional complementation studies?

Designing BCQ_3166 constructs for functional complementation studies requires careful consideration:

Expression control elements:

• Select promoters that match native expression levels (constitutive vs. inducible)

• Include native regulatory elements if expression timing is critical

• Consider integration location in the genome to avoid positional effects

Protein tagging strategy:

• C-terminal tags are preferable for membrane proteins with N-terminal signal sequences

• Use small tags (FLAG, HA) to minimize functional interference

• Include flexible linkers (GGGGS repeats) between the protein and tag

Construct validation approaches:

• Sequence verification to confirm construct integrity

• Expression level testing using quantitative Western blotting

• Localization confirmation using fluorescent tags or fractionation

For complementation studies in B. cereus, researchers should follow the transformation protocol using electroporation as described for CRISPR/Cas9 genome engineering, with selection on kanamycin (25 μg/ml) and appropriate induction of expression using systems compatible with B. cereus physiology .

What controls are essential when performing functional studies with BCQ_3166 knockout or overexpression strains?

When conducting functional studies with BCQ_3166 mutant strains, include these essential controls:

For knockout studies:

• Wild-type parent strain (positive control)

• Complemented mutant (knockout with restored BCQ_3166 expression)

• Control knockout of unrelated gene to assess general effects of genetic manipulation

• Multiple independent knockout clones to rule out off-target effects

For overexpression studies:

• Empty vector control (same vector backbone without BCQ_3166 gene)

• Strains expressing unrelated protein at similar levels

• Dose-response with varying expression levels

• Time-course studies to capture transient effects

Validation approaches:

• RT-qPCR to confirm transcript absence/overexpression

• Western blotting to verify protein levels

• Phenotypic rescue experiments for knockouts

• Whole genome sequencing to rule out secondary mutations

When creating knockout strains using CRISPR/Cas9, use multiple primer pairs for verification as demonstrated in the B. anthracis studies, where various primer combinations were used to confirm successful gene modifications .

How can researchers verify the subcellular localization of BCQ_3166 in Bacillus cereus?

Verifying BCQ_3166 subcellular localization requires multiple complementary approaches:

Biochemical fractionation methods:

• Membrane isolation through differential centrifugation

• Sequential extraction with increasing detergent strengths

• Density gradient separation of membrane fractions

• Western blot analysis of fractions using anti-BCQ_3166 antibodies

Microscopy-based approaches:

• Fusion proteins with fluorescent tags (GFP, mCherry) for live-cell imaging

• Immunofluorescence microscopy using fixed cells and specific antibodies

• Super-resolution microscopy (STORM, PALM) for precise localization

• Correlative light and electron microscopy for ultrastructural context

Control proteins for co-localization:

• Known membrane proteins (positive controls)

• Cytoplasmic proteins (negative controls)

• Proteins with similar predicted topology

Given BCQ_3166's predicted membrane association based on its hydrophobic amino acid sequences, particular attention should be paid to membrane fractionation methods and proper controls to distinguish between different membrane compartments in B. cereus .