Recombinant Bacillus cereus UPF0344 protein BCA_1194 (BCA_1194)

Shipped with Ice Packs
In Stock

Description

Introduction to Bacillus cereus and BCA_1194

Bacillus cereus is a Gram-positive, motile, spore-forming bacterium commonly found in various environments . It can grow both aerobically and anaerobically . Bacillus cereus is known for its ability to produce toxins that can cause foodborne illnesses . Recombinant Bacillus cereus UPF0344 protein BCA_1194, also known as BCA_1194, is a protein derived from Bacillus cereus . UPF0344 designates it as a protein of unknown function .

Characteristics of Recombinant BCA_1194 Protein

Recombinant BCA_1194 protein is produced using genetic engineering techniques, where the gene encoding BCA_1194 is inserted into a host organism (e.g., E. coli) for expression and production .

Key characteristics of Recombinant Bacillus cereus UPF0344 protein BCA_1194 (BCA_1194) Protein, His-Tagged :

  • Source: Expressed in E. coli

  • Tag: N-terminal His tag

  • Protein Length: Full Length (1-121 amino acids)

  • Form: Lyophilized powder

  • Purity: Greater than 90% as determined by SDS-PAGE

  • Storage: Store at -20°C/-80°C upon receipt, avoid repeated freeze-thaw cycles

  • Storage Buffer: Tris/PBS-based buffer, 6% Trehalose, pH 8.0

  • Gene Name: BCA_1194

  • Synonyms: BCA_1194; UPF0344 protein BCA_1194

  • UniProt ID: C1EL62

  • AA Sequence: MVHMHITAWALGLILFFVAYSLYSAGRKGKGVHMGLRLMYIIIIVTGFMLYMGIMKTATS NMHMWYGLKMVAGILVIGGMEMVLVKMSKNKATGAVWGLFIVALVAVFYLGLKLPIGWQV F

Gene Information

The gene name for this protein is BCA_1194, and it is also known as UPF0344 protein BCA_1194 . The UniProt ID for this protein is C1EL62 .

Function and Role

The function of BCA_1194 is currently unknown, as it is annotated as a protein of unknown function (UPF0344) . Further research is needed to elucidate its specific role in Bacillus cereus.

Potential Applications

Given that many proteins of Bacillus cereus, such as EntD, are linked to enterotoxin production, cell wall structure, motility, and biofilm formation, BCA_1194 could be relevant in similar contexts . Further research might reveal its involvement in pathogenesis or other cellular processes, making it a potential target for therapeutic interventions .

Bacillus cereus as a Human Pathogen

Bacillus cereus is recognized as a volatile human pathogen . It can cause emetic and diarrheal syndromes through the production of toxins . These toxins can lead to gastrointestinal issues when contaminated food is consumed .

Antimicrobial Properties and Bacterial Competition

Bacillus cereus strains can produce antimicrobial peptides (AMPs) to compete with other bacteria in their environment . For example, one strain, RC6, generates an AMP active against several Bacillus species and Listeria monocytogenes when grown in the presence of casein . These AMPs are generated through specific proteolysis, indicating the importance of proteases in bacterial competition .

Relevant Research

Proteomic studies have identified proteins like EntD as pivotal in the exoproteome of B. cereus, influencing its cytotoxic potential by modulating the expression of other proteins, including enterotoxins . Similarly, genomic analyses have revealed gene clusters associated with the synthesis of antimicrobial secondary metabolites, such as surfactin, bacillibactin, and fengycin, in Bacillus subtilis strains .

Tables

Table 1: Recombinant Full Length Bacillus cereus Upf0344 Protein Bca_1194 (Bca_1194) Protein, His-Tagged

Cat.No. :RFL4699BF
Product Overview:Recombinant Full Length Bacillus cereus UPF0344 protein BCA_1194 (BCA_1194) Protein (C1EL62) (1-121aa), fused to N-terminal His tag, was expressed in E. coli.
Species:Bacillus cereus
Source:E.coli
Tag:His
Protein Length:Full Length (1-121)
Form:Lyophilized powder

Product Specs

Form
Lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your format preference during ordering for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Consult your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and may serve as a guideline for your own preparations.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.
Note: If you require a specific tag type, please inform us, and we will prioritize its development.
Synonyms
BCA_1194; UPF0344 protein BCA_1194
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-121
Protein Length
full length protein
Species
Bacillus cereus (strain 03BB102)
Target Names
BCA_1194
Target Protein Sequence
MVHMHITAWALGLILFFVAYSLYSAGRKGKGVHMGLRLMYIIIIVTGFMLYMGIMKTATS NMHMWYGLKMVAGILVIGGMEMVLVKMSKNKATGAVWGLFIVALVAVFYLGLKLPIGWQV F
Uniprot No.

Target Background

Database Links

KEGG: bcx:BCA_1194

Protein Families
UPF0344 family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

How is the BCA_1194 gene organized in the Bacillus cereus genome?

The BCA_1194 gene belongs to the UPF0344 protein family, a group of uncharacterized proteins found across various bacterial species. In B. cereus, the gene is positioned within the chromosome in proximity to genes involved in membrane functions. The genomic context analysis can provide insights into potential functional relationships and evolutionary conservation patterns. Researchers should examine flanking genes to identify potential operons or functional gene clusters that might suggest coordinated expression or related functions.

What are the optimal conditions for expressing recombinant BCA_1194 protein in E. coli?

The expression of recombinant BCA_1194 protein has been successfully achieved in E. coli using the following optimized protocol:

  • Vector selection: pET-based expression vectors with N-terminal His-tag show good expression efficiency.

  • E. coli strain: BL21(DE3) strains are commonly used for membrane protein expression.

  • Induction conditions: 0.5-1.0 mM IPTG at OD600 0.6-0.8, with post-induction growth at 25°C for 4-6 hours to minimize inclusion body formation.

  • Media composition: LB medium supplemented with appropriate antibiotics based on the resistance marker in the expression vector .

For membrane proteins like BCA_1194, lower induction temperatures (16-25°C) often result in better folding and higher yields of soluble protein. Consider testing various E. coli strains specialized for membrane protein expression, such as C41(DE3) or C43(DE3).

What purification strategies yield the highest purity and activity for BCA_1194?

A multi-step purification approach is recommended for BCA_1194:

  • Initial capture: Immobilized metal affinity chromatography (IMAC) using Ni-NTA resin to capture the His-tagged protein.

  • Intermediate purification: Size exclusion chromatography to separate monomeric from oligomeric forms.

  • Detergent selection: For membrane proteins like BCA_1194, detergent screening is critical. Start with mild detergents like DDM or LDAO.

  • Buffer optimization: Tris/PBS-based buffer systems at pH 8.0 have shown good stability .

The purified protein can be stored with 6% trehalose as a stabilizing agent. Greater than 90% purity can be achieved using this approach, as determined by SDS-PAGE analysis .

How should I properly store and handle purified BCA_1194 protein to maintain activity?

For optimal storage and handling of BCA_1194 protein:

  • Short-term storage: Keep working aliquots at 4°C for up to one week.

  • Long-term storage: Store at -20°C/-80°C in Tris/PBS-based buffer with 6% trehalose (pH 8.0).

  • Reconstitution protocol: Centrifuge vials briefly before opening to collect contents at the bottom. Reconstitute in deionized sterile water to 0.1-1.0 mg/mL.

  • Stability enhancement: Add glycerol to a final concentration of 5-50% (50% is commonly used) and aliquot for long-term storage.

  • Avoid freeze-thaw cycles: Repeated freezing and thawing significantly reduces protein activity .

How can I design experiments to determine the membrane topology of BCA_1194?

To determine the membrane topology of BCA_1194, implement a multi-method approach:

  • Computational prediction: Use transmembrane prediction algorithms (TMHMM, Phobius, TOPCONS) to generate initial topology models.

  • Cysteine scanning mutagenesis: Introduce cysteine residues at strategic positions and assess their accessibility to membrane-impermeable sulfhydryl reagents.

  • GFP-fusion approach: Create fusion constructs with GFP at various positions and analyze fluorescence localization.

  • Protease protection assays: Express the protein in membrane vesicles and determine which regions are protected from protease digestion.

The sequence characteristics of BCA_1194 suggest multiple transmembrane domains, making it critical to employ complementary methods to resolve potential ambiguities in topology models:

MethodAdvantagesLimitationsData Output
Computational predictionRapid, requires only sequenceVariable accuracyPredicted TM segments
Cysteine scanningDirect experimental evidenceLabor-intensiveResidue-specific membrane location
GFP-fusionVisualizes termini locationMay disrupt foldingTerminal orientation
Protease protectionMaps accessible regionsResolution limited to large domainsDomain protection patterns

What approaches can be used to identify potential interaction partners of BCA_1194?

To identify interaction partners of BCA_1194, consider these methodological approaches:

  • Bacterial two-hybrid system: Optimized for membrane proteins to detect direct protein-protein interactions.

  • Co-immunoprecipitation with crosslinking: Use membrane-permeable crosslinkers followed by pull-down with anti-His antibodies.

  • Proximity-dependent biotin labeling (BioID): Fuse BCA_1194 with a biotin ligase to label proximal proteins.

  • Chemical crosslinking coupled with mass spectrometry: Identify crosslinked peptides to map interaction interfaces.

For membrane proteins like BCA_1194, standard interaction assays often require modification. The hydrophobic nature of BCA_1194 suggests it may associate with other membrane components or participate in protein complexes involved in cell envelope functions.

How can I study the expression pattern of BCA_1194 under different growth conditions?

To analyze BCA_1194 expression patterns:

  • qRT-PCR analysis: Design specific primers for BCA_1194 and reference genes appropriate for B. cereus.

  • Promoter-reporter fusions: Clone the BCA_1194 promoter region upstream of a reporter gene (GFP, luciferase) to monitor expression in various conditions.

  • RNA-Seq: Perform transcriptome analysis under different growth conditions to identify co-regulated genes.

  • Western blotting: Use specific antibodies against BCA_1194 or the His-tag to quantify protein levels.

When designing expression studies, consider testing conditions that might reveal the protein's function:

  • Different growth phases (exponential vs. stationary)

  • Stress conditions (osmotic, oxidative, pH, temperature)

  • Nutrient limitations

  • Presence of potential substrates or signaling molecules

What techniques can be employed to determine the three-dimensional structure of BCA_1194?

For structural determination of BCA_1194:

For a 121-amino acid membrane protein like BCA_1194, a hybrid approach combining multiple techniques may be most effective. Initial characterization using circular dichroism spectroscopy can provide secondary structure content before pursuing higher-resolution methods.

How can I determine if BCA_1194 forms oligomeric structures in the membrane?

To investigate oligomerization of BCA_1194:

  • Blue native PAGE: Separate native protein complexes while maintaining protein-protein interactions.

  • Chemical crosslinking coupled with SDS-PAGE: Use membrane-permeable crosslinkers of varying lengths to capture transient interactions.

  • Analytical ultracentrifugation: Determine sedimentation coefficients of detergent-solubilized protein.

  • FRET analysis: Create fluorescently labeled BCA_1194 variants to detect proximity in membranes.

  • Single-molecule tracking: Analyze diffusion patterns that might indicate complex formation.

The hydrophobic nature of BCA_1194's sequence suggests potential for oligomerization or interaction with other membrane components. When analyzing results, consider that detergent selection can significantly impact the observed oligomeric state.

How should I design single-case experimental designs (SCEDs) for studying phenotypic effects of BCA_1194 mutations?

When designing SCEDs to study BCA_1194 mutations:

  • Baseline establishment: Thoroughly characterize wild-type BCA_1194 expression and phenotype before introducing mutations.

  • Control selection: Include both positive controls (mutations in known functional residues) and negative controls (mutations in non-conserved residues).

  • Experimental phases:

    • A-phase: Baseline measurements

    • B-phase: Introduction of mutation

    • Follow-up: Return to wild-type conditions if possible

  • Measurement variables: Select phenotypes likely to be affected based on sequence analysis and predicted function.

SCEDs are particularly valuable when working with membrane proteins like BCA_1194 where subtle phenotypic changes might be observed . Ensure experimental design includes sufficient sampling points to detect changes in bacterial growth, membrane integrity, or stress responses.

How can I formulate a robust research question for investigating BCA_1194 function?

To formulate a robust research question about BCA_1194 function, follow the "FINERMAPS" criteria :

  • Feasible: "Can the function of BCA_1194 be determined through comparative genomic analysis combined with targeted gene knockout in B. cereus?"

  • Interesting: Focus on novel aspects, such as potential roles in membrane integrity or stress response.

  • Novel: Address gaps in current understanding of UPF0344 family proteins.

  • Ethical: Ensure laboratory safety protocols for working with B. cereus strains.

  • Relevant: Connect to broader understanding of bacterial membrane biology.

  • Manageable: Define specific aspects of function rather than attempting to characterize all possible roles.

  • Appropriate: Ensure methods align with the research question.

Example of a well-structured research question: "What role does the UPF0344 protein BCA_1194 play in membrane homeostasis in B. cereus during osmotic stress, and which conserved amino acid residues are essential for this function?"

This question is clear, focused, complex (not answerable with yes/no), and requires both research and analysis .

How should I approach the analysis of contradictory results in BCA_1194 functional studies?

When encountering contradictory results in BCA_1194 studies:

  • Systematic verification:

    • Re-examine experimental conditions, particularly detergent selection for membrane protein studies

    • Verify protein identity and integrity by mass spectrometry

    • Assess potential contamination or degradation issues

  • Context-dependent function analysis:

    • Test if contradictory results arise from different growth conditions or genetic backgrounds

    • Consider post-translational modifications that might alter function

    • Examine if oligomeric state varies between experimental setups

  • Statistical approach:

    • Perform meta-analysis if multiple datasets are available

    • Calculate effect sizes rather than relying solely on statistical significance

    • Use Bayesian analysis to incorporate prior knowledge

Membrane proteins often show context-dependent behaviors. Create a comprehensive table documenting all experimental variables when comparing results across different studies or conditions.

What statistical methods are most appropriate for analyzing phenotypic data from BCA_1194 mutant strains?

For statistical analysis of BCA_1194 mutant phenotypes:

  • For continuous measurements (growth rates, membrane permeability):

    • ANOVA with post-hoc tests for multiple comparisons between wild-type and various mutants

    • Linear mixed-effects models to account for batch effects and repeated measurements

    • Non-parametric alternatives (Kruskal-Wallis) if normality assumptions are violated

  • For survival/viability data:

    • Kaplan-Meier survival analysis for time-to-event data

    • Cox proportional hazards models to assess the impact of specific mutations

  • For high-dimensional data (transcriptomics, proteomics):

    • Principal component analysis to identify patterns

    • Hierarchical clustering to group similar mutant phenotypes

    • Gene set enrichment analysis to identify affected pathways

When designing experiments, ensure sufficient biological replicates (minimum n=3) and consider technical replicates to assess measurement variability. Power analysis should be performed prior to experimentation to determine appropriate sample sizes.

How might BCA_1194 be utilized in synthetic biology applications?

Potential synthetic biology applications for BCA_1194:

  • Membrane protein engineering platform:

    • BCA_1194's relatively small size (121 aa) makes it amenable to modification

    • Can serve as a scaffold for designing novel membrane-spanning domains

    • Potential for creating chimeric proteins with sensor/reporter functions

  • Bacterial surface display:

    • Fusion partners for antigen presentation on bacterial surfaces

    • Development of whole-cell biosensors

  • Minimal membrane protein systems:

    • Contribution to minimal genome projects

    • Understanding fundamental requirements for membrane protein folding and function

The successful expression system for BCA_1194 in E. coli provides a foundation for these applications, as high-yield production can be achieved using optimized conditions described earlier .

What emerging technologies could advance our understanding of BCA_1194 function?

Emerging technologies with potential to advance BCA_1194 research:

  • CryoET (Cryo-electron tomography):

    • Visualize BCA_1194 in its native membrane environment

    • Determine spatial organization and potential interactions

  • AlphaFold2 and related AI structure prediction:

    • Generate high-confidence structural models even without experimental structures

    • Predict interaction interfaces and functional sites

  • In-cell NMR:

    • Study conformational changes in near-native conditions

    • Detect ligand binding in cellular context

  • Genome-wide interaction screens:

    • CRISPR interference (CRISPRi) screens to identify genetic interactions

    • TransposonSeq to identify synthetic lethal interactions

  • Single-cell technologies:

    • Track protein localization and dynamics at single-molecule resolution

    • Correlate expression with phenotypic heterogeneity

These technologies could help resolve the function of this uncharacterized protein family and place BCA_1194 in its proper cellular and evolutionary context.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.