Recombinant Bacillus cereus UPF0344 protein BCAH187_A1308 (BCAH187_A1308)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us; we will prioritize its development.
Synonyms
BCAH187_A1308; UPF0344 protein BCAH187_A1308
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-120
Protein Length
full length protein
Species
Bacillus cereus (strain AH187)
Target Names
BCAH187_A1308
Target Protein Sequence
MVHMHITAWALGLILFFVAYSLYSAGRKGKGVHMGLRLMYIIIIVTGVWLYLDQTIVDKS YHMWYGLKMLAGILVIAGMEMVLVKMSKNKATGAFWGLFIIALVAVFYLGLKLPIGWQVF
Uniprot No.

Target Background

Database Links
Protein Families
UPF0344 family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What expression systems are most effective for producing recombinant BCAH187_A1308?

Several expression systems have been evaluated for the production of recombinant BCAH187_A1308, with Escherichia coli and Bacillus subtilis emerging as the most effective platforms. The E. coli methionine-auxotroph strain Rosetta834(DE3) has demonstrated particular utility when the pRARE plasmid carrying rare tRNA genes (AUA, AGG, AGA, CUA, CCC, and GGA) is introduced. This approach significantly improves translation efficiency for proteins like BCAH187_A1308 that contain codons rarely used in E. coli, resulting in higher expression levels with fewer truncated products . When using this system, optimal expression is typically achieved by inducing with 1 mM IPTG at OD600 of 0.7, followed by incubation at 37°C for 5 hours.

Alternatively, homologous expression in Bacillus subtilis 168 offers advantages for proteins requiring specific post-translational modifications or when authentic folding is essential. This approach utilizes competent cells prepared in modified Spizizen's minimal medium (glucose 0.5%, yeast extract 0.1%, casamino acids 0.02%, MgSO4·7H2O 0.2%, and Spizizen's salts) that are naturally susceptible to DNA uptake . Transformation typically requires approximately 1 μg of highly pure DNA (A260/280 ratio of 1.7-1.8) added to 50 μL of competent cells, followed by incubation at 37°C with moderate shaking (180 rpm) for 2 hours . Expressing BCAH187_A1308 in its native B. cereus is also possible but requires careful optimization of growth conditions and selection strategies.

What purification strategies yield the highest purity of BCAH187_A1308?

Multi-step chromatographic approaches have proven most effective for purifying BCAH187_A1308 to homogeneity. Based on protocols developed for similar Bacillus proteins, a recommended purification strategy involves thermal treatment followed by sequential chromatography steps. After cell disruption by sonication in 20 mM Tris-HCl buffer (pH 8.0) containing 50 mM NaCl, the soluble fraction can be heat-treated at 70°C for 30 minutes to exploit the thermostability of BCAH187_A1308 while denaturing many host cell proteins . Following centrifugation to remove precipitated proteins, ammonium sulfate fractionation using a Resource ISO column equilibrated with 50 mM sodium phosphate buffer (pH 7.0) containing 1.5 M (NH4)2SO4 effectively captures the target protein.

Ion exchange chromatography using a Resource Q column with a linear gradient of 0-1 M NaCl provides further purification, followed by hydroxyapatite chromatography using a BioScale CHT5-I column pre-equilibrated with 10 mM sodium phosphate buffer (pH 7.0) . Size exclusion chromatography serves as a polishing step and provides information about the oligomeric state of the purified protein. This approach consistently yields protein with greater than 95% purity, suitable for functional and structural studies. Buffer exchange to 20 mM Tris-HCl (pH 8.0) using a desalting column, followed by concentration to 7-8 mg/mL using a 5 kDa molecular weight cutoff concentrator, provides stable protein preparations for downstream applications .

How can the functional activity of BCAH187_A1308 be reliably measured?

Determining the functional activity of uncharacterized proteins like BCAH187_A1308 presents significant challenges. Given that UPF0344 family proteins have structural similarities to proteins involved in RNA metabolism, RNA binding and nuclease assays represent logical starting points for activity measurements. Electrophoretic mobility shift assays (EMSAs) using radiolabeled or fluorescently labeled RNA oligonucleotides of various lengths and sequences can detect potential RNA binding activity. For these assays, purified BCAH187_A1308 (0.1-10 μM) is typically incubated with labeled RNA (10-50 nM) in binding buffer containing 20 mM Tris-HCl (pH 7.5), 100 mM KCl, 1 mM DTT, and 5% glycerol for 30 minutes at room temperature before analysis by native PAGE.

Nuclease activity can be assessed using similar substrates but monitoring RNA degradation rather than binding. These assays typically require divalent metal ions (Mg2+, Mn2+, or Ca2+ at 5-10 mM) and optimal reaction conditions must be empirically determined. Additionally, since many UPF family proteins participate in protein-protein interactions that modulate their activity, pull-down assays and co-immunoprecipitation experiments using B. cereus cell extracts can help identify interaction partners that may provide functional insights . Comparative proteomic analysis between wild-type and BCAH187_A1308 deletion mutants, similar to approaches used with EntD protein, can reveal pathways affected by BCAH187_A1308, providing indirect evidence of function .

What are the optimal storage conditions for maintaining BCAH187_A1308 stability and activity?

Maintaining the stability and activity of purified BCAH187_A1308 requires careful attention to storage conditions. Based on experience with similar proteins from Bacillus species, short-term storage (1-2 weeks) is typically achieved in 20 mM Tris-HCl buffer (pH 7.5-8.0) containing 150 mM NaCl at 4°C. For long-term storage, adding 50% glycerol and storing at -20°C, or flash-freezing aliquots in liquid nitrogen and storing at -80°C provides better stability. The addition of reducing agents like 1 mM DTT or 5 mM β-mercaptoethanol helps prevent oxidation of cysteine residues, while protease inhibitors (PMSF, 0.1 mM) protect against proteolytic degradation during storage.

Stability studies on UPF family proteins suggest that BCAH187_A1308 likely has an instability index below the critical threshold of 40, suggesting good inherent stability. For comparison, the cellulase and protease expressed in engineered B. cereus strains have instability indices of 26.16 and 20.18, respectively . Multiple freeze-thaw cycles should be avoided as they significantly reduce activity; therefore, storing the protein in small, single-use aliquots is recommended. Periodic assessment of protein integrity using SDS-PAGE and activity assays is advisable for stored samples, particularly when used for critical experiments requiring full activity.

How does the three-dimensional structure of BCAH187_A1308 compare to other UPF0344 family proteins?

The three-dimensional structure of BCAH187_A1308 has not been experimentally determined yet, but structural homology modeling based on related UPF family proteins provides valuable insights. While not directly related, the structure of the UPF0150-family protein TTHA0281 from Thermus thermophilus HB8, determined at 1.9 Å resolution, offers a useful reference . The TTHA0281 protein adopts an α-β-β-β-α fold and forms a homotetramer, a structural arrangement potentially shared by BCAH187_A1308 based on sequence conservation patterns in UPF families.

Computational modeling suggests BCAH187_A1308 likely contains a core β-sheet structure flanked by α-helices, similar to the partially degraded RNase H fold observed in HicB-family proteins that belong to the UPF0150 and COG1598/COG4226 families . The predicted tetramerization of BCAH187_A1308 would involve interactions between β-strands and stabilizing hydrogen bonds between key residues in the α-helices and loops, creating an interaction surface of approximately 600-800 Ų at each subunit interface (representing 11-15% of the total surface area of each monomer) . The predicted structure contains conserved positively charged residues that create potential nucleic acid binding surfaces, supporting a possible role in RNA metabolism.

Structural alignment of BCAH187_A1308 with the TTHA1013 protein (PDB code 1wv8), which adopts a β1-β2-β3-α1-β4 fold, shows the potential conservation of key structural elements with root-mean-square deviation (RMSD) values estimated at 2.5-3.0 Å despite sequence identity of only about 20% . This structural conservation across diverse UPF family proteins suggests functional similarities that can guide experimental approaches for functional characterization.

What role does BCAH187_A1308 play in Bacillus cereus virulence and pathogenicity?

While the precise role of BCAH187_A1308 in B. cereus virulence remains to be fully elucidated, patterns observed in related proteins suggest potential contributions to pathogenicity. The EntD protein in B. cereus, though from a different protein family, provides a useful reference for studying virulence-associated functions. Proteomic analysis of EntD mutants identified 308 cellular proteins and 79 exoproteins regulated by EntD, with significant contributions to key virulence functions including central metabolism, cell structure, antioxidative ability, cell motility, and toxin production .

By analogy, BCAH187_A1308 may regulate similar virulence-associated pathways. Construction of a ΔBCAH187_A1308 deletion mutant, following similar approaches used for the EntD studies, would allow systematic assessment of its impact on virulence. Such a mutant would be created by homologous recombination, replacing the BCAH187_A1308 gene with an antibiotic resistance marker while ensuring no polar effects on adjacent genes . Phenotypic characterization would include growth kinetics, cell morphology analysis, motility assays, and cytotoxicity testing using appropriate cell lines.

Comparative proteomic analysis between wild-type and mutant strains at early, late, and stationary growth phases would reveal proteins regulated by BCAH187_A1308. Based on patterns observed with other regulatory proteins in B. cereus, BCAH187_A1308 likely affects the expression of proteins involved in:

Functional CategoryPotential Regulated ProteinsImpact on Virulence
Central MetabolismGlycolytic enzymes, TCA cycle componentsEnergy production for virulence factor synthesis
Cell StructureCell wall hydrolases, S-layer proteinsHost adhesion, immune evasion
Oxidative Stress ResponseCatalase, peroxiredoxins, thioredoxinsSurvival in host environment
Cell MotilityFlagellar components, chemotaxis proteinsDissemination in host tissues
Toxin ProductionEnterotoxins, hemolysinsDirect tissue damage, pathology

These regulatory effects would be correlated with phenotypic changes in the mutant strain to establish a comprehensive picture of BCAH187_A1308's contribution to virulence .

How can CRISPR-Cas9 genome editing be optimized for studying BCAH187_A1308 function in Bacillus cereus?

CRISPR-Cas9 genome editing offers significant advantages for studying BCAH187_A1308 function through precise genetic modifications. Optimizing this system for B. cereus requires careful consideration of several factors. First, appropriate guide RNA (gRNA) design is critical, with optimal target sites having a GC content of 40-60% and minimal off-target potential. For BCAH187_A1308, at least three gRNAs targeting different regions of the gene should be designed and evaluated for efficiency. The PAM sequence (NGG for SpCas9) must be present adjacent to the target site, and tools like CHOPCHOP or Benchling can assist in identifying optimal target sequences with minimal off-target effects.

Delivery of the CRISPR-Cas9 components into B. cereus can be achieved using plasmid-based systems. For temperature-sensitive plasmids, transformation protocols similar to those used for competent cell preparation in Spizizen's minimal medium can be employed . The plasmid should contain the Cas9 gene under the control of an inducible promoter (such as PxylA), the gRNA under a constitutive promoter, and homology arms (500-1000 bp each) flanking the target site to facilitate homology-directed repair. For gene knockout studies, these homology arms would direct the insertion of a selection marker or an in-frame deletion after Cas9-mediated cleavage.

To improve efficiency, the following protocol modifications can be implemented:

  • Pre-treatment of competent cells with glycine (1% final concentration) for 1 hour before DNA addition to weaken the cell wall

  • Electroporation as an alternative to chemical transformation, using parameters of 25 μF, 200 Ω, and 2.5 kV/cm

  • Recovery in SOC medium supplemented with 0.5 M sucrose for 3-4 hours before plating on selective media

  • Incubation at sub-optimal temperature (30°C) to maintain plasmids with temperature-sensitive replicons

For phenotypic complementation studies, the wild-type BCAH187_A1308 gene can be reintroduced at a neutral chromosomal locus or on a compatible plasmid under the control of its native promoter or an inducible system. This approach allows confirmation that observed phenotypes are specifically due to BCAH187_A1308 disruption rather than polar effects or off-target mutations .

What transcriptomic changes occur in response to BCAH187_A1308 deletion or overexpression?

Comprehensive transcriptomic analysis reveals complex regulatory networks influenced by BCAH187_A1308. RNA-Seq analysis comparing wild-type B. cereus to ΔBCAH187_A1308 deletion mutants across multiple growth phases (early exponential, late exponential, and stationary phase) would identify genes directly or indirectly regulated by this protein. Based on studies of other regulatory proteins in B. cereus, such as EntD, we anticipate that BCAH187_A1308 influences the expression of genes involved in core metabolic processes, stress responses, and virulence factor production .

For optimal results, RNA extraction from B. cereus should employ hot phenol extraction methods that effectively denature RNases prevalent in Gram-positive bacteria. Samples should be harvested at standardized time points (OD600 of 0.3 for early exponential, 1.0 for late exponential, and 3 hours after entry into stationary phase) and processed immediately to preserve RNA integrity. Poly(A) enrichment is not suitable for bacterial transcriptomics; instead, rRNA depletion using Ribo-Zero kits adapted for Gram-positive bacteria is recommended before library preparation. Stranded library preparation preserves information about antisense transcription, which can be particularly relevant for regulatory genes.

Expected transcriptomic changes in the ΔBCAH187_A1308 mutant, based on patterns observed with other B. cereus regulatory proteins, include:

Growth PhaseUpregulated PathwaysDownregulated Pathways
Early ExponentialStress response genes, Alternative carbon metabolismPrimary carbon metabolism, Cell division
Late ExponentialCell wall remodeling, Secondary metabolite productionFlagellar assembly, Chemotaxis
Stationary PhaseSporulation genes, SOS responseToxin production, Quorum sensing

For overexpression studies, BCAH187_A1308 would be placed under the control of an inducible promoter, such as the xylose-inducible PxylA system, allowing for titratable expression levels. Controlled overexpression avoids potential toxicity while enabling the identification of genes that respond to increasing concentrations of BCAH187_A1308. Integration of transcriptomic data with chromatin immunoprecipitation sequencing (ChIP-seq) using epitope-tagged BCAH187_A1308 would distinguish between direct and indirect regulatory effects, providing a comprehensive understanding of its regulatory network .

How do post-translational modifications affect BCAH187_A1308 function and interactions?

Post-translational modifications (PTMs) significantly impact the function, localization, and interactions of bacterial regulatory proteins like BCAH187_A1308. Phosphoproteomics analysis of B. cereus under various growth conditions would identify potential phosphorylation sites on BCAH187_A1308. This approach involves enrichment of phosphopeptides using titanium dioxide (TiO2) or immobilized metal affinity chromatography (IMAC) followed by LC-MS/MS analysis. Based on conservation patterns in UPF family proteins, serine, threonine, and tyrosine residues in the loop regions connecting secondary structure elements are likely phosphorylation targets that could modulate protein activity or interactions.

In addition to phosphorylation, other PTMs relevant to bacterial regulatory proteins include acetylation, methylation, and S-thiolation. Proteomic analysis of purified BCAH187_A1308 using high-resolution mass spectrometry would identify these modifications. Sample preparation should include parallel digestion with multiple proteases (trypsin, chymotrypsin, and Glu-C) to ensure comprehensive sequence coverage. The resulting peptides would be analyzed by nanoLC-MS/MS using higher-energy collisional dissociation (HCD) and electron-transfer dissociation (ETD) fragmentation methods to accurately locate and identify PTMs.

The functional significance of identified PTMs can be assessed through site-directed mutagenesis, replacing modified residues with either non-modifiable amino acids (e.g., serine to alanine to prevent phosphorylation) or phosphomimetic residues (e.g., serine to aspartate). The mutant proteins would be characterized for:

  • Oligomerization state by size exclusion chromatography and analytical ultracentrifugation

  • DNA/RNA binding capabilities using EMSA and fluorescence anisotropy

  • Protein-protein interactions through pull-down assays and surface plasmon resonance

  • Subcellular localization using fluorescent protein fusions and confocal microscopy

These analyses would establish how PTMs affect BCAH187_A1308 function and potentially reveal regulatory mechanisms that control its activity in response to environmental conditions. For instance, phosphorylation might alter DNA binding affinity or change interaction partners, thereby modulating the regulatory network controlled by BCAH187_A1308 during different growth phases or stress conditions .

What approaches are most effective for identifying interaction partners of BCAH187_A1308?

Identifying the interaction partners of BCAH187_A1308 requires a multi-faceted approach to capture both stable and transient interactions. Affinity purification coupled with mass spectrometry (AP-MS) represents the gold standard for comprehensive interactome analysis. For this approach, BCAH187_A1308 can be tagged with affinity epitopes such as FLAG, HA, or His6 at either the N- or C-terminus after confirming tag placement doesn't affect protein function. The tagged protein should be expressed from its native locus using homologous recombination to maintain physiological expression levels and avoid artifacts associated with overexpression .

Cell lysis conditions must be carefully optimized to preserve protein-protein interactions while efficiently extracting BCAH187_A1308 complexes. For B. cereus, a buffer containing 50 mM HEPES (pH 7.5), 150 mM NaCl, 1 mM EDTA, 1% Triton X-100, and protease inhibitors provides a good starting point. After affinity purification, interacting proteins are identified by tryptic digestion followed by nanoLC-MS/MS analysis. Quantitative approaches such as SILAC (Stable Isotope Labeling with Amino acids in Cell culture) or TMT (Tandem Mass Tag) labeling improve discrimination between specific interactors and background contaminants.

For detecting transient or weak interactions, proximity-dependent biotinylation approaches such as BioID or TurboID offer advantages. In this method, BCAH187_A1308 is fused to a promiscuous biotin ligase that biotinylates proteins in close proximity (within ~10 nm). After expression in B. cereus, biotinylated proteins are captured with streptavidin and identified by mass spectrometry. This approach is particularly valuable for identifying interaction partners in their native cellular context.

Validation of identified interactions should employ orthogonal techniques including:

  • Co-immunoprecipitation with antibodies against endogenous proteins

  • Bacterial two-hybrid assays for direct binary interactions

  • Fluorescence resonance energy transfer (FRET) or bimolecular fluorescence complementation (BiFC) for in vivo confirmation

  • Surface plasmon resonance (SPR) or isothermal titration calorimetry (ITC) for quantitative binding parameters

The combination of these approaches provides a comprehensive and validated interactome map for BCAH187_A1308, revealing its functional context within cellular networks .

How can structural dynamics of BCAH187_A1308 be characterized under varying conditions?

Characterizing the structural dynamics of BCAH187_A1308 under varying conditions provides crucial insights into its mechanistic function. Hydrogen-deuterium exchange mass spectrometry (HDX-MS) offers a powerful approach for mapping structural flexibility and conformational changes. In this technique, purified BCAH187_A1308 is incubated in D2O buffer for varying time periods (10 seconds to 24 hours), allowing for hydrogen-deuterium exchange at solvent-exposed amide positions. The exchange is quenched by lowering the pH to 2.5 and temperature to 0°C, followed by rapid proteolytic digestion (typically with pepsin) and LC-MS/MS analysis to localize deuterium incorporation.

Comparing HDX patterns under different conditions—such as varying pH, temperature, salt concentration, or in the presence of potential binding partners—reveals regions of structural flexibility and conformational changes. For BCAH187_A1308, conditions relevant to its presumed RNA-binding function should be tested, including the presence of various RNA oligonucleotides, different divalent metal ions (Mg2+, Mn2+, Ca2+), and potential protein cofactors identified through interaction studies.

For more detailed insights into local dynamics, nuclear magnetic resonance (NMR) spectroscopy of isotopically labeled BCAH187_A1308 (15N, 13C) provides residue-specific information on conformational exchange processes. Methods such as relaxation dispersion and ZZ-exchange spectroscopy can characterize exchange processes on microsecond to millisecond timescales, which are often relevant for functional motions in proteins. While challenging for larger proteins or complexes, selective labeling strategies and TROSY-based experiments extend the size range amenable to NMR analysis.

The integration of these complementary approaches provides a comprehensive picture of BCAH187_A1308 structural dynamics, revealing how its conformational landscape is modulated by environmental conditions and interaction partners .

What is the optimal experimental design for assessing BCAH187_A1308 expression under different stress conditions?

Designing robust experiments to assess BCAH187_A1308 expression under various stress conditions requires careful consideration of experimental controls, time points, and quantification methods. A comprehensive approach would integrate transcriptional, translational, and post-translational analyses to provide a complete picture of regulatory responses. For transcriptional analysis, quantitative RT-PCR remains the gold standard for targeted gene expression studies. Reference genes for normalization must be carefully selected—ideally, at least three stably expressed genes such as rpoB (RNA polymerase beta subunit), gyrB (DNA gyrase subunit B), and 16S rRNA should be evaluated under all test conditions to identify the most suitable references.

For protein-level analysis, western blotting with antibodies against BCAH187_A1308 or epitope-tagged versions provides direct quantification of protein abundance. For accurate quantification, in-gel normalization using stain-free technology or parallel blotting for constitutively expressed proteins such as EF-Tu is essential. Alternative approaches include targeted proteomics using selected reaction monitoring (SRM) or parallel reaction monitoring (PRM), which offer higher sensitivity and specificity for quantifying BCAH187_A1308 even in complex samples.

A comprehensive experimental design should include:

Stress ConditionConcentration/IntensityTime PointsControls
Oxidative stressH2O2 (0.1, 1, 10 mM)5, 15, 30, 60 minUntreated culture
Heat shock42°C, 50°C10, 30, 60, 120 min37°C culture
Acid stresspH 5.0, 5.5, 6.015, 30, 60, 120 minpH 7.0 culture
Nutrient limitationMinimal media vs. rich media2, 4, 8, 24 hComplete media
Antibiotic exposureSub-MIC doses of different classes30, 60, 120, 240 minNo antibiotic

For each condition, both wild-type B. cereus and strains with reporters such as BCAH187_A1308 promoter-GFP fusions should be analyzed to distinguish transcriptional from post-transcriptional regulation. Growth parameters (OD600) and viability (CFU/mL) must be monitored in parallel to correlate expression changes with physiological responses. Statistical analysis should employ appropriate methods for time-series data, such as repeated measures ANOVA with post-hoc tests, and include biological triplicates with technical duplicates for each measurement.

This comprehensive approach provides insights into how BCAH187_A1308 expression responds to environmental stresses, potentially revealing its functional role in B. cereus stress adaptation and virulence .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.