Recombinant Bacillus cereus UPF0344 protein BCAH820_1232 (BCAH820_1232)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in your order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a reference.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
Tag type is determined during production. To ensure a specific tag, please inform us in advance, and we will prioritize its development.
Synonyms
BCAH820_1232; UPF0344 protein BCAH820_1232
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-121
Protein Length
full length protein
Species
Bacillus cereus (strain AH820)
Target Names
BCAH820_1232
Target Protein Sequence
MVHMHITAWALGLILFFVAYSLYSAGRKGKGVHMGLRLMYIIIIVTGFMLYMGIMKTATS NMHMWYGLKMIAGILVIGGMEMVLVKMSKNKATGAVWGLFIVALVAVFYLGLKLPIGWQV F
Uniprot No.

Target Background

Database Links
Protein Families
UPF0344 family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is Bacillus cereus and why is the UPF0344 protein BCAH820_1232 significant?

Bacillus cereus is a gram-positive, facultative anaerobic bacterium widely distributed in the environment and food products. B. cereus can cause food poisoning through various toxins and has demonstrated antimicrobial resistance . The UPF0344 protein BCAH820_1232 belongs to a family of uncharacterized proteins that may play roles in bacterial physiology, virulence, or environmental adaptation. Research into these uncharacterized proteins can reveal novel bacterial functions and potential targets for antimicrobial development.

How do I confirm the identity of purified recombinant BCAH820_1232?

Confirmation requires multiple approaches:

  • Mass spectrometry analysis comparing observed molecular weight with theoretical predictions

  • N-terminal sequencing of at least 10-15 amino acids

  • Western blot using antibodies against the protein or fusion tag

  • Peptide mass fingerprinting after tryptic digestion

  • Verification of expected post-translational modifications

These methods should be used in combination, as relying on a single approach may lead to misidentification. Where possible, compare results against known standards or previously characterized batches of the protein.

What expression systems are optimal for producing recombinant BCAH820_1232?

Based on experience with Bacillus proteins, consider the following systems and conditions:

Expression SystemAdvantagesDisadvantagesOptimal Conditions
E. coli BL21(DE3)High yield, cost-effectivePotential inclusion body formation16-20°C induction, 0.1-0.5mM IPTG, 16h
E. coli RosettaAddresses rare codon usageHigher cost25°C induction, 0.5mM IPTG, 4-6h
Bacillus subtilisBetter folding for Bacillus proteinsLower yield30°C, native promoter systems
Cell-free systemAvoids toxicity issuesExpensive, lower yield30°C, 4-6h reaction time

For challenging proteins, codon optimization and fusion with solubility tags (MBP, SUMO, or TrxA) may significantly improve expression. Monitor protein solubility at each condition using small-scale test expressions analyzed by SDS-PAGE.

What purification strategy yields the highest purity BCAH820_1232?

A multi-step purification approach is recommended:

  • Initial capture: Immobilized metal affinity chromatography (IMAC) if His-tagged

  • Intermediate purification: Ion exchange chromatography (consider isoelectric point)

  • Polishing: Size exclusion chromatography

  • Buffer optimization: Test pH range 6.0-8.0, NaCl concentration 50-300mM

  • Stability enhancers: Consider adding 5-10% glycerol or 1-5mM reducing agent

Monitor purity at each step using SDS-PAGE and assess activity using appropriate functional assays. For structural studies, aim for >95% purity with minimal aggregation as determined by dynamic light scattering.

How can I design an effective knockout system to study BCAH820_1232 function in B. cereus?

For gene deletion in B. cereus, consider these approaches:

  • Homologous recombination: Design constructs with 800-1000bp homology arms flanking a selectable marker

  • CRISPR-Cas9 system: Design sgRNAs with minimal off-target effects

  • Inducible antisense RNA: For essential genes where knockout is lethal

  • Marker-free deletion: Use Cre-lox system for clean deletions

When designing knockout verification:

  • PCR verification with primers outside the recombination region

  • Sequencing of junction regions

  • RT-PCR and Western blot to confirm absence of transcript and protein

  • Complementation studies to confirm phenotype is due to targeted deletion

Phenotypic analysis should include growth curves under various conditions and comparative virulence gene expression profiling .

What bioinformatics approaches help predict BCAH820_1232 function?

Implement a comprehensive sequence-to-function prediction pipeline:

  • Homology searches: BLASTp, Pfam, and HHpred to identify related proteins

  • Structural predictions: AlphaFold, I-TASSER, or SWISS-MODEL

  • Functional site prediction: ConSurf for conserved residues, 3DLigandSite for binding pocket prediction

  • Genomic context analysis: Examine adjacent genes and potential operons

  • Co-expression data: Identify genes with similar expression patterns

  • Cross-species conservation: Compare with homologs in related Bacillus species

Carefully evaluate prediction confidence scores and cross-validate findings between different tools. Focus particularly on conserved residues that may indicate functional sites.

How do I analyze potential roles of BCAH820_1232 in virulence gene regulation?

Examining relationships between BCAH820_1232 and virulence requires:

  • Transcriptomic analysis: Compare wild-type and knockout strains using RNA-seq

  • Quantitative assessment of known virulence genes: Focus on enterotoxin-encoding hblACD and nheABC gene clusters, entFM, cytK, and cesB genes

  • Chromatin immunoprecipitation (ChIP-seq): If the protein might have DNA-binding properties

  • Electrophoretic mobility shift assays (EMSA): Test direct interaction with virulence gene promoters

  • Reporter assays: Construct promoter-reporter fusions for key virulence genes

Since enterotoxin genes are present in varying patterns across B. cereus strains (with nheABC present in 83% of strains versus hblACD in only 39% ), a comprehensive assessment across multiple genetic backgrounds is recommended.

What techniques are most informative for analyzing protein-protein interactions involving BCAH820_1232?

Multiple complementary approaches should be employed:

TechniqueApplicationAdvantagesLimitations
Bacterial two-hybridIn vivo screeningNative bacterial environmentLimited to binary interactions
Pull-down assaysIn vitro verificationDirect biochemical evidenceMay miss transient interactions
Cross-linking MSComplex identificationCaptures weak interactionsTechnical complexity
Surface plasmon resonanceBinding kineticsQuantitative binding parametersRequires purified proteins
Co-immunoprecipitationEndogenous verificationIdentifies native complexesRequires specific antibodies
Proximity labeling (BioID)In situ mappingIdentifies spatial neighborsHigher false positive rate

When analyzing results, prioritize interactions detected by multiple methods and focus on proteins with related functions or co-expression patterns.

How can I investigate BCAH820_1232's potential role in antimicrobial resistance?

Given that B. cereus commonly shows resistance to β-lactam antibiotics and rifamycin , investigate potential connections through:

  • Comparative antibiotic susceptibility testing: Compare wild-type, knockout, and overexpression strains using standardized methods

  • Expression analysis: Measure BCAH820_1232 expression changes in response to antibiotic exposure

  • Resistance mechanism studies: Examine potential interactions with known resistance pathways

  • Binding studies: Test direct interaction with antibiotics using techniques like isothermal titration calorimetry

  • Structure-function analysis: Identify structural features that might contribute to resistance mechanisms

Data should be interpreted in light of the known resistance profiles of B. cereus and related species, considering potential horizontal gene transfer events.

What approaches can determine if BCAH820_1232 contributes to B. cereus environmental adaptation?

Since B. cereus has been isolated from diverse environments including desert biological soil crusts , investigate adaptation roles through:

  • Comparative growth assays: Test knockout strains under various stress conditions (temperature, pH, osmotic stress, nutrient limitation)

  • Biofilm formation assessment: Quantify changes in attachment and biofilm development

  • Stress response gene expression: Monitor expression changes during environmental transitions

  • Metabolic profiling: Measure changes in central metabolism and nutrient utilization

  • Competition assays: Perform co-culture experiments with wild-type under stress conditions

For soil adaptation studies, consider examining potential roles in producing extracellular enzymes like amylase, protease, and cellulase, which have been found in environmental B. cereus strains .

How do I design structure-function studies for BCAH820_1232 when the function is unknown?

A systematic approach includes:

  • Structural characterization: Obtain high-resolution structures using X-ray crystallography or cryo-EM

  • Conserved domain analysis: Identify evolutionarily conserved regions likely to be functionally important

  • Site-directed mutagenesis: Target predicted active sites or binding pockets

  • Truncation analysis: Create domain deletions to isolate functional regions

  • Chimeric proteins: Swap domains with homologs to identify functional specificity

When designing mutations, focus on:

  • Strictly conserved residues across multiple species

  • Residues with unusual conservation patterns

  • Predicted binding site residues

  • Surface-exposed patches of conserved residues

For each variant, conduct comprehensive functional assays to correlate structural features with specific activities.

How do I resolve contradictory results in BCAH820_1232 functional studies?

When facing conflicting data:

  • Evaluate methodological differences: Examine experimental conditions, strain backgrounds, and technical approaches

  • Assess statistical rigor: Review sample sizes, statistical tests, and potential outliers

  • Consider context-dependency: Protein function may vary with environmental conditions or growth phase

  • Examine post-translational modifications: Function may depend on specific modifications

  • Design decisive experiments: Create experiments specifically targeting the contradiction

  • Consult literature for similar proteins: Related proteins may show similar context-dependent behaviors

Document all contradictions thoroughly in publications rather than selectively reporting supportive data, as apparent contradictions often lead to deeper understanding of complex systems.

What statistical approaches are most appropriate for analyzing BCAH820_1232 phenotypic data?

Statistical analysis should be tailored to experimental design:

Data TypeAppropriate TestsSample Size ConsiderationsValidation Approaches
Growth curvesRepeated measures ANOVA, area under curve analysisMinimum 3 biological replicates with 3 technical replicates eachGrowth in different media formulations
Gene expressionDESeq2 or EdgeR for RNA-seq, t-tests for qPCR3-6 biological replicatesValidation of key genes by qPCR
Protein interactionSignificance analysis of interactome (SAINT)3+ replicate purificationsReciprocal purifications, targeted validation
Phenotypic screensMann-Whitney U or t-tests with multiple testing correctionPower analysis to determine sample sizeSecondary phenotypic assays

For all analyses, clearly state effect sizes alongside p-values, and consider biological significance beyond statistical significance.

How can findings about BCAH820_1232 contribute to food safety applications?

Given B. cereus' prevalence in ready-to-eat foods (found in 35% of samples in some studies ), translational research could:

  • Develop rapid detection methods: Create antibodies or aptamers targeting BCAH820_1232 if it's consistently expressed

  • Identify intervention targets: If the protein contributes to survival in food processing conditions

  • Understand strain virulence: Correlate protein variants with toxin production capacity

  • Improve risk assessment: Associate protein features with persistent environmental contamination

Any translational applications should consider the diversity of B. cereus strains and the variable distribution of virulence factors across isolates as documented in multilocus sequence typing studies .

What considerations are important when designing a BCAH820_1232 knockout for biological safety studies?

When evaluating biological safety:

  • Use multiple strain backgrounds: Test effects in diverse B. cereus lineages, especially those with different virulence gene profiles

  • Comprehensive toxin assessment: Measure all major toxins (HBL, NHE, cytotoxin K, emetic toxin)

  • Environmental persistence studies: Evaluate survival under various conditions

  • Host interaction models: Use appropriate cell culture or animal models

  • Genomic stability analysis: Ensure knockout stability over multiple generations

Safety studies should reference the known distribution of virulence genes in B. cereus (hblACD: 39%, nheABC: 83%, cytK: 68%, cesB: 7%, entFM: 100% ) to properly contextualize results.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.