Recombinant Bacillus cereus UPF0344 protein BCB4264_A1205 (BCB4264_A1205)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for fulfillment according to your requirements.
Lead Time
Delivery times vary depending on the purchasing method and location. Please consult your local distributor for precise delivery estimates.
Note: Proteins are shipped with standard blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to settle the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on several factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during the production process. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
BCB4264_A1205; UPF0344 protein BCB4264_A1205
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-121
Protein Length
full length protein
Species
Bacillus cereus (strain B4264)
Target Names
BCB4264_A1205
Target Protein Sequence
MVHMHITAWALGLILFFVAYSLYSAGRKGKGVHMGLRLMYIIIIVTGFMLYMSIVKTATG SMHMWYGLKMLAGILVIGGMEMVLVKMSKNKPTGAVWGLFIVALVAVFYLGLKLPIGWKV F
Uniprot No.

Target Background

Database Links
Protein Families
UPF0344 family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is the Bacillus cereus UPF0344 protein BCB4264_A1205 and what are its basic characteristics?

The BCB4264_A1205 is a protein belonging to the UPF0344 family, found in Bacillus cereus strain B4264 . It is classified as a multi-pass membrane protein localized to the cell membrane, though its precise function remains to be fully characterized . The UPF0344 designation indicates it belongs to an "Uncharacterized Protein Family," suggesting its biological role is not yet well defined in scientific literature. The protein's gene name is BCB4264_A1205, and it can be identified in databases such as KEGG (KEGG:bcb:BCB4264_A1205) .

When working with this protein, researchers should note that recombinant versions are typically produced as partial sequences rather than the full-length protein, which may influence experimental design considerations . Structurally, as a membrane protein, it contains multiple transmembrane domains, which presents specific challenges for expression, purification, and structural studies.

Which expression systems are suitable for recombinant production of BCB4264_A1205?

BCB4264_A1205 can be expressed in multiple heterologous systems, each offering distinct advantages and limitations for research applications. The protein has been successfully produced in:

  • Bacterial systems (E. coli) - Offering high yield and rapid production

  • Yeast systems - Providing eukaryotic post-translational modifications

  • Baculovirus-infected insect cells - Suitable for complex proteins requiring specific folding

  • Mammalian cell lines - Providing human-like post-translational modifications

When expressing membrane proteins like BCB4264_A1205, consideration must be given to membrane insertion efficiency and proper folding. HEK293 cells grown in suspension have shown particular utility for membrane protein expression, as they combine reasonable yields with appropriate eukaryotic cellular machinery for processing .

What purification strategies are most effective for BCB4264_A1205?

The purification of BCB4264_A1205 requires specialized approaches due to its membrane protein nature. Based on standard practices for similar proteins, the following methodological workflow is recommended:

  • Membrane fraction isolation: Begin with cell lysis followed by differential centrifugation to isolate membrane fractions containing the target protein .

  • Detergent screening: Test multiple detergents for optimal solubilization while maintaining protein stability and function. Common options include:

    • Mild detergents (DDM, LMNG) for gentle extraction

    • Stronger detergents (SDS, Triton X-100) for higher yield but potential denaturation

  • Affinity chromatography: Utilize the recombinant tag for initial purification. The BCB4264_A1205 protein can be produced with various tags, including Avi-tag biotinylation, which allows for highly specific purification using streptavidin-based affinity methods .

  • Size exclusion chromatography: Apply as a polishing step to separate monomeric protein from aggregates and contaminants.

For BCB4264_A1205 specifically, reconstitution after purification may be necessary if functional studies are planned. Protein quality should be assessed using SDS-PAGE, with expected purity of >85% as typically reported for commercial preparations .

How can structural studies of BCB4264_A1205 be optimized given its membrane protein characteristics?

Structural characterization of membrane proteins like BCB4264_A1205 presents significant challenges that require specialized methodological approaches. For optimal results, consider implementing the following strategies:

  • Cryo-EM sample preparation optimization:

    • Use amphipathic polymers (amphipols) or nanodiscs to stabilize the protein in a membrane-like environment

    • Screen detergent:protein ratios systematically to minimize aggregation

    • Consider GraFix (gradient fixation) method to improve particle homogeneity

  • Crystallization approaches:

    • Implement lipidic cubic phase (LCP) crystallization methods specifically designed for membrane proteins

    • Screen with various lipids that mimic the bacterial membrane composition of B. cereus

    • Consider fusion protein approaches (e.g., T4 lysozyme fusion) to increase soluble domains for crystal contacts

  • NMR considerations:

    • For solution NMR, selective isotopic labeling of specific domains may provide insights into dynamic regions

    • Solid-state NMR may be applied to the protein reconstituted in native-like lipid bilayers

The UPF0344 family's uncharacterized nature means structural studies of BCB4264_A1205 could provide valuable insights into potential functional roles . When designing structural studies, consider that membrane proteins often require specialized handling at each step, from expression through purification and final structural analysis, with particular attention to maintaining the native-like membrane environment or suitable mimetics.

What approaches can be used to elucidate the function of BCB4264_A1205 given its uncharacterized status?

Determining the function of uncharacterized proteins like BCB4264_A1205 requires a multi-faceted approach combining computational predictions, comparative analyses, and experimental validation. The following methodological framework is recommended:

  • Computational analysis:

    • Apply sequence-based predictions (HMMER, BLAST) to identify distant homologs with known functions

    • Use structural prediction (AlphaFold2, RoseTTAFold) to generate models that may suggest functional motifs

    • Analyze genomic context (adjacent genes) in B. cereus for functional clues through guilt-by-association

  • Experimental functional screening:

    • Conduct phenotypic analysis of knockout or knockdown strains

    • Perform protein-protein interaction studies using pull-down assays coupled with mass spectrometry

    • Implement metabolomic profiling comparing wild-type and mutant strains

  • Localization and expression pattern analysis:

    • Use fluorescent protein fusions to confirm membrane localization and possible dynamic behaviors

    • Examine expression patterns under various stress conditions relevant to B. cereus lifecycle

For a membrane protein like BCB4264_A1205, particular attention should be paid to potential roles in:

  • Nutrient transport

  • Signaling

  • Antibiotic resistance

  • Virulence factor expression

The UPF0344 family designation indicates structural similarities with other proteins in this group, which may provide starting hypotheses for functional investigation . Consider that B. cereus is known for its pathogenic potential in food contamination contexts, so functional studies might illuminate roles in virulence or survival mechanisms .

How can protein-protein interaction studies be designed for BCB4264_A1205 to identify potential binding partners?

Identifying interaction partners for membrane proteins requires specialized techniques that account for the hydrophobic nature of these proteins. For BCB4264_A1205, the following methodological approaches are recommended:

  • Membrane-specific yeast two-hybrid systems:

    • Implement split-ubiquitin membrane yeast two-hybrid (MYTH) specifically designed for membrane proteins

    • Use a B. cereus genomic library as prey to screen against BCB4264_A1205 as bait

  • Proximity-dependent labeling in native context:

    • Apply BioID or APEX2 fusions to BCB4264_A1205 expressed in B. cereus

    • Analyze biotinylated proteins via mass spectrometry to identify proteins in close proximity

  • Co-immunoprecipitation with crosslinking:

    • Use membrane-permeable crosslinkers to stabilize transient interactions

    • Solubilize with optimized detergent conditions before immunoprecipitation

    • Identify partners using mass spectrometry

  • Bacterial two-hybrid systems:

    • Adapt bacterial adenylate cyclase-based two-hybrid (BACTH) system for membrane protein analysis

    • Screen against B. cereus library components

When analyzing results from these approaches, prioritize proteins that appear across multiple independent methods and consider enrichment for other membrane proteins or proteins with related functions. For validation of identified interactions, techniques such as FRET, BiFC, or SPR with purified components can provide quantitative interaction parameters.

Table 1: Comparison of Protein-Protein Interaction Methods for Membrane Proteins

MethodAdvantagesLimitationsSuitability for BCB4264_A1205
Split-ubiquitin MYTHDesigned for membrane proteins; in vivo detectionLimited to yeast expressionHigh
BioID/APEX2Works in native bacterial context; captures transient interactionsRequires genetic manipulation of B. cereusVery high
Crosslinked co-IPCan detect weak/transient interactionsMay capture non-specific interactionsModerate
BACTHBacterial-based system closer to native environmentMay miss interactions requiring specific lipid contextHigh

What are the challenges in expressing the full-length BCB4264_A1205 protein, and how can they be addressed?

Full-length membrane protein expression presents numerous challenges that require systematic optimization. For BCB4264_A1205, which is typically produced as a partial protein, the following strategies can help achieve successful full-length expression:

  • Toxicity mitigation:

    • Implement tightly controlled inducible promoters (e.g., tetracycline-regulated systems)

    • Use lower growth temperatures (16-20°C) after induction to slow production and improve folding

    • Consider specialized E. coli strains (C41, C43) engineered for toxic membrane protein expression

  • Codon optimization:

    • Analyze and optimize the codon usage for the expression host

    • Remove rare codons that might cause translational pausing and misfolding

  • Expression system selection:

    • For full-length membrane proteins, insect cell or mammalian expression systems often provide better results than bacterial systems

    • HEK293 suspension culture provides a balance of yield and proper processing for complex membrane proteins

  • Solubilization and stabilization strategies:

    • Screen detergent panels systematically (from mild to harsh)

    • Consider novel solubilization approaches like SMALPs (styrene maleic acid lipid particles) that extract membrane proteins with their native lipid environment

    • Test fusion partners that enhance solubility (SUMO, MBP, thioredoxin)

The recombinant production of BCB4264_A1205 is typically performed using partial protein constructs, suggesting that the full-length protein may present expression challenges . Carefully analyze the protein sequence to identify potential problematic regions, such as highly hydrophobic segments or sequences predicted to be disordered, which could be modified or temporarily removed for initial expression trials.

What quality control measures should be implemented when working with recombinant BCB4264_A1205?

Rigorous quality control is essential when working with recombinant proteins, particularly membrane proteins like BCB4264_A1205. Implement the following methodological quality control workflow:

  • Purity assessment:

    • SDS-PAGE analysis with both Coomassie and silver staining

    • Consider native PAGE for oligomeric state analysis

    • Aim for >85% purity as typically reported for this protein

  • Identity confirmation:

    • Western blotting using tag-specific antibodies

    • Mass spectrometry peptide fingerprinting

    • N-terminal sequencing for absolute confirmation

  • Structural integrity evaluation:

    • Circular dichroism (CD) to assess secondary structure content

    • Fluorescence spectroscopy to evaluate tertiary structure

    • Size exclusion chromatography to analyze monodispersity

  • Functional verification:

    • Develop binding assays for potential ligands

    • For membrane proteins, reconstitution into liposomes and functional testing

    • Activity assays based on predicted function

Each production batch should undergo these quality control measures to ensure consistency across experiments. For BCB4264_A1205 specifically, monitor the protein after freeze-thaw cycles, as membrane proteins often show decreased stability after freezing. If storing the protein, consider maintaining it in a glycerol-containing buffer (5-50% glycerol) as recommended for similar recombinant preparations .

How can expression yields of BCB4264_A1205 be optimized across different expression systems?

Optimizing expression yields requires systematic variation of parameters specific to each expression system. The following methodological approaches are recommended for BCB4264_A1205:

  • E. coli system optimization:

    • Test multiple E. coli strains (BL21, Rosetta, C41/C43)

    • Vary induction parameters (inducer concentration, temperature, duration)

    • Implement auto-induction media for gradual protein production

    • Consider co-expression with chaperones (GroEL/GroES, DnaK/DnaJ)

  • Yeast system enhancement:

    • Compare P. pastoris and S. cerevisiae platforms

    • Optimize methanol induction protocols for P. pastoris

    • Test different signal sequences for secretion efficiency

  • Insect cell optimization:

    • Compare flashBAC versus BacMagic baculovirus systems

    • Optimize multiplicity of infection (MOI) and harvest timing

    • Consider stable cell lines for consistent production

  • Mammalian cell approaches:

    • Evaluate transient versus stable expression

    • Implement HEK293 suspension culture for scalability

    • Optimize transfection reagents and DNA:reagent ratios

    • Test serum-free versus serum-containing media

Table 2: Expression System Comparison for Membrane Protein Production

Expression SystemTypical YieldProcessing CapabilityCostTime RequirementSuitability for BCB4264_A1205
E. coliHighLimitedLowFast (days)Moderate (for functional studies)
YeastMediumMediumMediumMedium (1-2 weeks)Good (balance of yield/processing)
Baculovirus/InsectMedium-HighHighHighSlow (2-3 weeks)Very good (for structural studies)
MammalianLow-MediumVery HighVery HighMedium-Slow (1-3 weeks)Excellent (for functional studies)

For advanced yield optimization, consider implementing DoE (Design of Experiments) approaches to systematically identify optimal conditions with fewer experiments. When working with membrane proteins like BCB4264_A1205, monitor not just total protein yield but also the proportion correctly inserted into membranes, as this is often the limiting factor for functional studies .

What strategies can resolve common issues in BCB4264_A1205 protein purification?

Membrane protein purification frequently encounters specific challenges that require targeted troubleshooting approaches. For BCB4264_A1205, implement the following methodological solutions to common problems:

  • Poor solubilization:

    • Systematically screen detergent type, concentration, and buffer conditions

    • Test mixtures of detergents that combine properties (e.g., DDM+CHS)

    • Consider longer solubilization times at lower temperatures

    • Try novel solubilization agents (SMALPs, nanodiscs, amphipols)

  • Protein aggregation:

    • Add stabilizing agents (glycerol, specific lipids, cholesterol)

    • Reduce protein concentration during purification steps

    • Maintain low temperatures throughout purification

    • Test additives that prevent hydrophobic interactions (arginine, low concentrations of secondary detergents)

  • Low binding to affinity resins:

    • Verify tag accessibility - membrane proteins may have buried tags

    • Extend binding times for equilibration

    • Reduce flow rates during affinity chromatography

    • Consider dual tagging strategies for improved purification

  • Proteolytic degradation:

    • Include multiple protease inhibitors in all buffers

    • Reduce purification time and steps

    • Maintain samples at 4°C throughout

    • Consider adding stabilizing ligands if known

For BCB4264_A1205 specifically, the commercial preparations indicate successful purification to >85% purity , suggesting that standard membrane protein approaches can be effective with proper optimization. When troubleshooting, implement changes systematically and assess their impact using SDS-PAGE and functional assays before moving to the next modification.

How can researchers design experiments to investigate BCB4264_A1205's potential role in B. cereus pathogenicity?

Given that B. cereus is known to cause food poisoning and produce various toxins, investigating BCB4264_A1205's potential role in pathogenicity requires a structured experimental approach:

  • Knockout/knockdown studies:

    • Generate clean deletion mutants of BCB4264_A1205 in B. cereus

    • Assess virulence phenotypes in cell culture and animal models

    • Evaluate toxin production in mutant versus wild-type strains

  • Expression analysis during infection:

    • Quantify BCB4264_A1205 expression under conditions mimicking host environments

    • Compare expression in virulent versus attenuated strains

    • Analyze co-expression with known virulence factors using RT-qPCR

  • Interaction with host factors:

    • Implement pull-down assays using biotinylated BCB4264_A1205 against host cell lysates

    • Screen for binding to specific host cell types relevant to B. cereus infection

    • Test for potential immune evasion roles

  • Multilocus sequence typing correlation:

    • Apply MLST to analyze whether specific sequence types of BCB4264_A1205 correlate with virulence

    • Compare sequence variations across pathogenic and non-pathogenic strains

    • Identify potential functional domains through comparative genomics

B. cereus is known to harbor multiple virulence factors, including enterotoxins encoded by the hblACD and nheABC gene clusters . Experiments should investigate potential relationships between BCB4264_A1205 and these established virulence determinants. The study design should also consider B. cereus' resistance to multiple antibiotics, including β-lactams and rifamycin, as potential areas where membrane proteins might play a role .

What are the most effective methods for studying BCB4264_A1205 membrane topology and insertion?

Understanding membrane topology is crucial for membrane proteins like BCB4264_A1205. The following methodological approaches provide complementary information:

  • Experimental topology mapping:

    • Implement substituted cysteine accessibility method (SCAM) with membrane-permeable and impermeable reagents

    • Use fluorescence protease protection (FPP) assay with GFP fusions

    • Apply glycosylation mapping with strategically inserted glycosylation sites

  • Cryo-electron tomography approaches:

    • Visualize the protein in native membrane environments

    • Identify membrane-spanning regions and their orientation

    • Combine with gold-labeling for precise localization

  • Hydrogen-deuterium exchange mass spectrometry (HDX-MS):

    • Identify protected regions corresponding to transmembrane segments

    • Map solvent-accessible versus buried regions

    • Monitor dynamic changes under different conditions

  • Computational prediction validation:

    • Compare experimental results with predictions from TMHMM, HMMTOP, Phobius

    • Refine computational models based on experimental data

    • Generate consensus topology models integrating multiple approaches

For BCB4264_A1205 specifically, its classification as a multi-pass membrane protein indicates multiple transmembrane domains that should be experimentally verified. Understanding the topology will provide critical insights into potential functional domains and interaction surfaces that face either the cytoplasm or the extracellular/periplasmic space.

How can researchers assess potential functional differences between the full-length and partial BCB4264_A1205 proteins?

Comparing full-length and partial protein variants requires systematic functional characterization. Implement the following methodological workflow:

  • Comparative structural analysis:

    • Perform CD spectroscopy on both variants to assess secondary structure differences

    • Apply limited proteolysis to identify structurally distinct domains

    • Use thermal shift assays to compare stability profiles

  • Functional comparison assays:

    • Develop binding assays for potential ligands or interaction partners

    • Compare oligomerization tendencies via crosslinking or analytical ultracentrifugation

    • Assess membrane insertion efficiency in reconstituted systems

  • Complementation studies:

    • Express each variant in knockout B. cereus strains

    • Evaluate rescue of phenotypes for both variants

    • Quantify functional restoration metrics

  • Domain mapping:

    • Generate a series of truncation mutants to isolate functional domains

    • Perform activity assays on isolated domains

    • Identify minimal functional units within the protein

The fact that commercial recombinant preparations of BCB4264_A1205 are described as "partial" suggests possible challenges with the full-length protein or strategic decisions to focus on specific domains. This comparative approach will help determine whether the partial protein retains all essential functional elements or if the full-length version possesses additional activities.

What bioinformatic approaches can provide insights into BCB4264_A1205's potential function?

Computational analysis can provide valuable functional hypotheses for uncharacterized proteins like BCB4264_A1205. Implement the following bioinformatic workflow:

  • Advanced sequence analysis:

    • Apply profile hidden Markov models to detect distant homologs

    • Use position-specific scoring matrices to identify conserved functional motifs

    • Implement coevolution analysis to identify structurally or functionally coupled residues

  • Structural bioinformatics:

    • Generate AlphaFold2 or RoseTTAFold structural models

    • Perform structural alignment against known protein structures

    • Identify potential binding pockets or catalytic sites

  • Genomic context analysis:

    • Analyze gene neighborhood conservation across multiple Bacillus species

    • Identify frequently co-occurring genes (functional coupling)

    • Examine operon structures that include BCB4264_A1205

  • Systems biology integration:

    • Map BCB4264_A1205 into protein-protein interaction networks

    • Integrate expression data across multiple conditions

    • Apply guilt-by-association principles at the network level

The UPF0344 family designation indicates multiple proteins sharing similar sequences without characterized functions . Comparative analysis across this family may reveal conserved features suggesting functional roles. Additionally, the genomic context in B. cereus might provide clues, particularly if BCB4264_A1205 is part of an operon with genes of known function.

What are the most promising research directions for understanding BCB4264_A1205's biological significance?

Based on current knowledge gaps and the characteristics of BCB4264_A1205, several high-priority research directions emerge:

  • Structure-function relationship:

    • Determine high-resolution structure using cryo-EM or X-ray crystallography

    • Map functional domains to structural features

    • Identify potential ligand binding sites through computational and experimental approaches

  • Physiological role in B. cereus:

    • Characterize phenotypes of deletion mutants under various stress conditions

    • Investigate potential roles in antibiotic resistance mechanisms

    • Examine involvement in membrane integrity or transport functions

  • Evolutionary significance:

    • Analyze conservation patterns across Bacillus species and beyond

    • Identify selective pressures acting on the gene

    • Investigate horizontal gene transfer patterns if present

  • Pathogenicity connection:

    • Evaluate expression during infection processes

    • Test for interactions with host factors

    • Assess contribution to virulence using appropriate models

The UPF0344 protein family remains largely uncharacterized, making BCB4264_A1205 a valuable target for fundamental discovery research. Understanding its function could provide insights not only into B. cereus biology but potentially into broader bacterial membrane protein functions. Given B. cereus' importance as a food contaminant , connecting BCB4264_A1205 function to survival or virulence mechanisms could have significant practical implications for food safety.

How can researchers integrate BCB4264_A1205 studies into broader B. cereus pathogenicity research?

To maximize the impact of BCB4264_A1205 research within the broader context of B. cereus pathogenicity, consider the following integrative approaches:

  • Multi-omics integration:

    • Combine transcriptomics, proteomics, and metabolomics data to position BCB4264_A1205 in pathogenicity networks

    • Identify co-regulated genes during infection processes

    • Map protein to specific metabolic or virulence pathways

  • Connection to established virulence factors:

    • Investigate relationships with known enterotoxin clusters (hblACD, nheABC)

    • Examine co-expression patterns with the emetic toxin cereulide

    • Assess impacts on entFM and cytK toxin expression

  • Strain variation analysis:

    • Analyze BCB4264_A1205 sequence variations across B. cereus isolates with different virulence profiles

    • Apply MLST approaches to correlate specific sequence types with pathogenicity

    • Examine distribution across various clonal complexes

  • Host-pathogen interaction models:

    • Develop cell culture models to study BCB4264_A1205's role during infection

    • Consider 3D tissue models that better recapitulate host environments

    • Evaluate impact on key pathogenicity metrics (adhesion, invasion, toxin delivery)

By integrating BCB4264_A1205 research with broader B. cereus pathogenicity studies, researchers can establish whether this membrane protein plays a supportive role in virulence mechanisms or has independent functions. The high prevalence of B. cereus in ready-to-eat foods (35% positivity rate) and its resistance to multiple antibiotics highlight the importance of understanding all potential contributors to its pathogenicity .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.