Recombinant Bacillus cereus UPF0344 protein BCE33L1051 (BCE33L1051)

How is recombinant BCE33L1051 typically produced for research purposes?

Recombinant BCE33L1051 is typically produced using an E. coli expression system. The full-length protein (amino acids 1-120) is expressed with an N-terminal His tag to facilitate purification. After expression, the protein undergoes purification procedures, likely involving affinity chromatography utilizing the His tag. The final product is typically provided as a lyophilized powder with purity greater than 90% as determined by SDS-PAGE analysis .

The production process involves:

• Cloning the BCE33L1051 gene into an expression vector

• Transforming the construct into E. coli host cells

• Inducing protein expression under controlled conditions

• Cell lysis and protein extraction

• Purification using affinity chromatography

• Quality control via SDS-PAGE and other analytical methods

• Lyophilization for storage stability

What is the optimal storage condition for BCE33L1051 recombinant protein?

For optimal stability and activity maintenance, BCE33L1051 recombinant protein should be stored according to these guidelines:

The protein is typically reconstituted in deionized sterile water to a concentration of 0.1-1.0 mg/mL. It's important to note that repeated freeze-thaw cycles should be avoided as they can compromise protein integrity. The storage buffer typically consists of Tris/PBS-based buffer with 6% Trehalose at pH 8.0 for lyophilized formats, or Tris-based buffer with 50% glycerol for liquid formats .

What is the putative function of BCE33L1051 based on bioinformatic analysis?

While the exact function of BCE33L1051 has not been fully characterized experimentally, bioinformatic analysis provides several insights. As a member of the UPF0344 protein family, BCE33L1051 contains multiple predicted transmembrane domains, suggesting it likely functions as a membrane protein. The amino acid sequence suggests potential roles in:

Unlike the BC3310 efflux protein from B. cereus, which has been characterized as a multidrug transporter and belongs to the major facilitator superfamily, BCE33L1051 belongs to a different protein family (UPF0344) with less well-defined functions . Current understanding of its function remains limited, presenting opportunities for further functional characterization studies.

How can researchers design experiments to elucidate the functional role of BCE33L1051?

To determine the functional role of BCE33L1051, researchers should consider a multi-faceted experimental approach:

• Gene knockout studies: Create a deletion mutant of the BCE33L1051 gene in B. cereus, similar to approaches used for other B. cereus genes, and assess phenotypic changes .

• Heterologous expression systems: Express BCE33L1051 in model organisms like E. coli to study its function in a controlled genetic background .

• Protein-protein interaction studies:

  • Co-immunoprecipitation assays with tagged BCE33L1051

  • Bacterial two-hybrid screens

  • Proximity labeling approaches (BioID or APEX)

• Transcriptomic analysis: Perform RNA-Seq under various conditions to identify co-regulated genes that might provide functional clues.

• Structural studies: Conduct X-ray crystallography or cryo-EM to determine the three-dimensional structure of BCE33L1051.

• Comparative genomics: Analyze BCE33L1051 homologs across different bacterial species to identify conserved domains and potential functions.

These approaches should be conducted systematically, starting with expression analysis under different conditions to identify when the protein is most active, followed by functional studies based on these expression patterns .

What is known about the potential role of BCE33L1051 in B. cereus pathogenicity?

While BCE33L1051 has not been directly linked to B. cereus pathogenicity in the available literature, it's important to consider the broader context of B. cereus virulence factors. B. cereus produces various toxins that cause symptoms like vomiting and diarrhea in foodborne outbreaks .

Key considerations regarding BCE33L1051 and pathogenicity:

• Expression correlation: Research should examine whether BCE33L1051 expression correlates with the expression of known virulence factors such as hemolytic enterotoxins (hblA, hblC, hblD) or non-hemolytic enterotoxins (nheA, nheB, nheC) .

• Strain comparison: Compare BCE33L1051 sequence and expression across different B. cereus strains with varying pathogenicity, similar to analyses performed on LY01-LY09 strains .

• Membrane protein functions: As a predicted membrane protein, BCE33L1051 might be involved in:

  • Bacterial adhesion to host cells

  • Stress response during host colonization

  • Transport of compounds important for virulence

  • Resistance to host defense mechanisms

• Experimental verification: To determine its role in pathogenicity, researchers could use the following methods:

  • Virulence assays using BCE33L1051 knockout strains

  • Cell culture invasion/adhesion assays

  • Gene expression analysis during infection models

What are the recommended protocols for reconstitution and handling of recombinant BCE33L1051?

For optimal results when working with recombinant BCE33L1051, follow these detailed reconstitution and handling protocols:

Reconstitution Protocol:

• Briefly centrifuge the vial containing lyophilized protein before opening to ensure all material is at the bottom

• Reconstitute in deionized sterile water to achieve a concentration of 0.1-1.0 mg/mL

• For long-term storage, add glycerol to a final concentration of 50%

• Aliquot the reconstituted protein to minimize freeze-thaw cycles

• Store aliquots at -20°C to -80°C for extended storage

Working Solution Preparation:

• Thaw frozen aliquots rapidly at 37°C

• Keep the working solution at 4°C for up to one week

• Perform all dilutions in appropriate buffers maintained at 4°C

• When preparing working solutions, consider the experimental pH requirements (the protein is provided in a buffer at pH 8.0)

Quality Control Considerations:

• Verify protein integrity by SDS-PAGE before experimental use

• Assess protein activity through appropriate functional assays

• Monitor protein aggregation, which can affect functional studies

Following these protocols will help maintain protein stability and activity while minimizing experimental variability.

How can researchers design effective experiments to study BCE33L1051 interaction with other bacterial proteins?

Designing experiments to study protein-protein interactions involving BCE33L1051 requires a systematic approach:

Preliminary Screening Methods:

• Bacterial two-hybrid system: Fuse BCE33L1051 to one domain of a split transcription factor and potential interacting partners to the complementary domain

• Pull-down assays: Use His-tagged BCE33L1051 as bait and analyze pulled-down proteins by mass spectrometry

• Coimmunoprecipitation: Generate antibodies against BCE33L1051 or use the His tag for immunoprecipitation followed by interactome analysis

Validation and Characterization Methods:

• Biolayer interferometry (BLI) or surface plasmon resonance (SPR): Measure binding kinetics between BCE33L1051 and identified interaction partners

• FRET or BRET assays: Monitor protein-protein interactions in vivo by tagging BCE33L1051 and partner proteins with appropriate fluorophores

• Protein complementation assays: Split reporter proteins (e.g., luciferase) fused to BCE33L1051 and potential partners

Experimental Design Considerations:

• Include proper negative controls (non-related proteins) and positive controls (known interacting proteins)

• Consider the membrane-associated nature of BCE33L1051 when designing experiments – use detergents or membrane mimetics

• Account for potential conformational changes by testing different truncated versions of the protein

• Test interactions under various conditions (pH, ionic strength, temperature) to identify physiologically relevant interactions

By implementing this multi-layered approach, researchers can identify and characterize the BCE33L1051 interactome, providing insights into its biological function.

What methods should be used to analyze BCE33L1051 expression in different B. cereus strains?

To comprehensively analyze BCE33L1051 expression across different B. cereus strains, researchers should implement the following complementary methods:

Transcriptomic Analysis:

• Quantitative PCR (qPCR): Design specific primers for BCE33L1051 similar to those used for virulence factors (hblC, nheB, cesB) in B. cereus strains

• RNA-Seq: Perform whole transcriptome analysis to measure BCE33L1051 expression in context with global gene expression patterns

• Northern blotting: Use for validation of expression levels and transcript size determination

Proteomic Analysis:

• Western blotting: Generate BCE33L1051-specific antibodies or use anti-His antibodies for recombinant proteins

• Mass spectrometry: Use targeted proteomic approaches (MRM/PRM) for accurate quantification

• Immunofluorescence microscopy: Visualize protein localization within bacterial cells

Experimental Design Framework:

• Compare expression across phylogenetically diverse B. cereus strains

• Test expression under various conditions:

  • Different growth phases

  • Various stress conditions (pH, temperature, oxidative stress)

  • Host-mimicking environments

  • Exposure to antibiotics or antimicrobial peptides

• Include reference/housekeeping genes for normalization of expression data

• Correlate expression patterns with strain virulence characteristics

This comprehensive approach will provide insights into the regulation and potential function of BCE33L1051 across the B. cereus group.

How does BCE33L1051 compare to homologous proteins in other Bacillus species?

BCE33L1051 belongs to the UPF0344 protein family, which has members across various Bacillus species. A comparative analysis reveals important insights into its conservation and potential function:

Sequence Conservation Analysis:

The high sequence conservation among the B. cereus group (including B. anthracis and B. thuringiensis) suggests an important functional role, while the differences from more distant Bacillus species like B. subtilis may reflect adaptation to different ecological niches .

Structural Features Comparison:

• Transmembrane domain prediction shows conservation of membrane-spanning regions across species

• N-terminal signal sequences show greater variability than the core protein domains

• C-terminal regions demonstrate species-specific adaptations

Genomic Context Analysis:
Examining the genomic neighborhood of BCE33L1051 homologs across species can provide functional insights, revealing conserved operons or gene clusters that suggest functional relationships .

What bioinformatic tools and databases are most useful for analyzing BCE33L1051?

Researchers studying BCE33L1051 should utilize a comprehensive set of bioinformatic tools and databases:

Sequence Analysis Tools:

• BLAST and PSI-BLAST: For identifying homologs across bacterial species

• MUSCLE or Clustal Omega: For multiple sequence alignments of BCE33L1051 homologs

• MEGA or PhyML: For phylogenetic analysis to understand evolutionary relationships

• TMHMM or TOPCONS: For transmembrane domain prediction

• SignalP: For signal peptide prediction

Structural Prediction Tools:

• I-TASSER or AlphaFold: For 3D structure prediction

• ConSurf: For mapping conservation onto predicted structures

• ProSA and PROCHECK: For validating structural models

Functional Annotation Resources:

• UniProt: For curated protein information (Q63EL0 for BCE33L1051)

• InterPro and Pfam: For protein domain analysis

• STRING: For protein-protein interaction network prediction

• KEGG and BioCyc: For metabolic pathway context

Comparative Genomics Platforms:

• MicrobesOnline: For genomic context analysis

• IMG/M: For comparative analysis of microbial genomes

• PATRIC: For pathogen-specific genome analysis

By integrating data from these resources, researchers can generate testable hypotheses about BCE33L1051 function, guiding experimental design for functional characterization.

How can researchers predict the membrane topology and functional domains of BCE33L1051?

Predicting the membrane topology and functional domains of BCE33L1051 requires a multi-tool approach and careful integration of results:

Membrane Topology Prediction Strategy:

• Consensus approach: Use multiple prediction algorithms (TMHMM, HMMTOP, Phobius, TOPCONS) and identify consensus transmembrane regions

• Hydropathy analysis: Generate Kyte-Doolittle plots to visualize hydrophobic regions likely to form transmembrane segments

• Positive-inside rule application: Analyze the distribution of positively charged residues (Arg, Lys) which tend to be enriched on the cytoplasmic side of membrane proteins

Based on the amino acid sequence (MVHMHITAWALGLILFFVAYSLYSAGRKGKGVHMGLRLMYIIIIVTGVWLYLDQTIVDKSYHMWYGLKMLAGILVIAGMEMVLVKMSKNKATGAFWGLFIIALVAVFYLGLKLPIGWQVF), BCE33L1051 likely contains 3-4 transmembrane domains, with hydrophobic stretches separated by charged or polar residues .

Functional Domain Identification:

• Conserved domain search: Use CDD, SMART, or InterPro to identify known functional domains

• Motif analysis: Scan for known functional motifs using PROSITE or ELM

• Secondary structure prediction: Use PSIPRED or JPred to identify structurally important regions

• Conservation mapping: Align homologs to identify highly conserved residues likely important for function

Experimental Validation Approaches:

• Cysteine scanning mutagenesis: Systematically replace residues with cysteine and test accessibility

• Reporter fusion analysis: Create fusions with reporter proteins at different positions to determine orientation

• Protease protection assays: Test which regions are protected from proteolytic digestion when in membrane vesicles

This integrated computational and experimental approach will provide a comprehensive model of BCE33L1051's membrane topology and guide functional studies.

What are common challenges in working with recombinant BCE33L1051 and how can they be addressed?

Researchers working with recombinant BCE33L1051 may encounter several challenges due to its nature as a membrane protein. Here are common issues and their solutions:

Protein Solubility Issues:

• Challenge: Poor solubility due to hydrophobic transmembrane domains
  Solution: Use appropriate detergents (DDM, LDAO, or mild detergents like CHAPS) or lipid nanodiscs to maintain protein in solution

• Challenge: Protein aggregation during storage or handling
  Solution: Add stabilizing agents (glycerol, trehalose), optimize buffer conditions, and maintain constant low temperature during handling

Protein Activity Assessment:

• Challenge: Difficulty in establishing functional assays for a protein of unknown function
  Solution: Design broad screening assays testing multiple potential functions, including membrane transport, binding studies, and interaction with known B. cereus cellular components

• Challenge: Loss of activity during purification or storage
  Solution: Minimize time between purification and use, validate activity through multiple orthogonal assays, and consider co-expression with stabilizing partners

Expression and Purification Problems:

• Challenge: Low expression yields in heterologous systems
  Solution: Optimize codon usage for expression host, test different promoters and induction conditions, or try specialized membrane protein expression strains

• Challenge: Contamination with host proteins
  Solution: Implement additional purification steps beyond His-tag affinity, such as ion exchange or size exclusion chromatography

• Challenge: Inclusion body formation
  Solution: Express at lower temperatures (16-20°C), use fusion partners known to enhance solubility, or develop refolding protocols if necessary

How can researchers troubleshoot experiments when studying BCE33L1051 function in B. cereus?

When investigating BCE33L1051 function in native B. cereus systems, researchers should be prepared to address these specific challenges:

Gene Manipulation Challenges:

• Challenge: Difficulty creating gene knockouts or mutations
  Solution: Use optimized transformation protocols specific for B. cereus, consider CRISPR-Cas9 systems adapted for Gram-positive bacteria, or use antisense RNA approaches as alternatives to complete gene deletion

• Challenge: Polar effects on neighboring genes when manipulating BCE33L1051
  Solution: Design constructs with minimal impact on operon structure, use marker-less deletion techniques, or complement with the wild-type gene to confirm phenotypes

Phenotype Analysis Issues:

• Challenge: Subtle or condition-dependent phenotypes
  Solution: Test multiple growth conditions (varying temperature, pH, salt concentration, nutrient availability) and use high-throughput phenotypic arrays (e.g., Biolog) to identify conditions where phenotypes become apparent

• Challenge: Redundant functions masking phenotypes
  Solution: Consider creating multiple gene knockouts if homologs or functionally redundant proteins are identified, or overexpress BCE33L1051 to amplify its effects

Expression Analysis Problems:

• Challenge: Low or variable expression of native BCE33L1051
  Solution: Optimize RNA extraction protocols for B. cereus, use highly sensitive qRT-PCR methods with validated reference genes, or develop reporter gene fusions to monitor expression

• Challenge: Cross-reactivity of antibodies
  Solution: Develop highly specific antibodies targeting unique regions of BCE33L1051 or use epitope tagging approaches combined with tag-specific antibodies

What experimental controls are essential when studying BCE33L1051 in different research contexts?

Proper experimental controls are critical for generating reliable and interpretable data when working with BCE33L1051:

For Recombinant Protein Studies:

• Expression controls: Include empty vector controls processed identically to BCE33L1051-expressing constructs

• Purification controls: Purify an unrelated His-tagged protein using identical protocols to control for purification artifacts

• Tag interference controls: Compare proteins with different tag positions (N-terminal vs. C-terminal) or removable tags

• Storage stability controls: Analyze protein quality after different storage conditions and durations

For Functional Characterization:

• Positive controls: Include well-characterized proteins with known functions similar to hypothesized roles of BCE33L1051

• Negative controls: Use proteins from unrelated pathways or denatured BCE33L1051

• Dose-response relationships: Test multiple concentrations to establish specificity of observed effects

• Time-course experiments: Monitor effects over time to distinguish primary from secondary effects

For Genetic Studies in B. cereus:

• Complementation controls: Restore wild-type phenotype by reintroducing BCE33L1051

• Cis vs. trans effects: Test whether observed phenotypes are due to BCE33L1051 itself or effects on neighboring genes

• Strain background controls: Perform manipulations in multiple B. cereus strains to ensure observations are not strain-specific

• Growth phase controls: Assess phenotypes at different growth phases as membrane protein functions may be growth-phase dependent

These controls will help researchers distinguish genuine BCE33L1051-specific effects from experimental artifacts or non-specific phenomena.

What are the most promising research directions for understanding BCE33L1051 function?

Based on current knowledge and research methodologies, several high-priority research directions could significantly advance understanding of BCE33L1051:

Structural Biology Approaches:

• Determine high-resolution structure using cryo-EM or X-ray crystallography

• Conduct molecular dynamics simulations to understand conformational changes

• Perform hydrogen-deuterium exchange mass spectrometry to identify flexible regions

Functional Genomics:

• Create a comprehensive knockout/knockdown library in different B. cereus strains

• Conduct transcriptomic analysis comparing wild-type and BCE33L1051 mutants under various conditions

• Perform transposon mutagenesis screens to identify genetic interactions with BCE33L1051

Physiological Role Investigation:

• Assess membrane potential and ion flux in wild-type versus BCE33L1051 mutants

• Investigate stress response capabilities, particularly to environmental challenges

• Evaluate potential roles in antimicrobial resistance mechanisms

• Examine involvement in sporulation or germination processes

Host-Pathogen Interaction Studies:

• Test BCE33L1051 mutants in infection models to assess virulence contributions

• Investigate immune recognition of BCE33L1051 by host cells

• Examine BCE33L1051 expression during different stages of infection

These multidisciplinary approaches would collectively provide a comprehensive understanding of BCE33L1051's role in B. cereus biology and potentially reveal novel therapeutic targets.

How might BCE33L1051 research contribute to understanding B. cereus pathogenicity?

Research on BCE33L1051 has the potential to significantly enhance our understanding of B. cereus pathogenicity through several mechanisms:

Virulence Regulation:
If BCE33L1051 functions as a membrane sensor or transporter, it may be involved in detecting host environments and triggering expression of virulence factors. Similar to how other membrane proteins function in pathogens, BCE33L1051 could participate in quorum sensing or environmental adaptation during infection .

Toxin Secretion:
As a membrane protein, BCE33L1051 might contribute to the secretion machinery for toxins such as the cereulide emetic toxin or enterotoxins. Comparative analysis with known toxin secretion systems could reveal functional similarities .

Stress Resistance During Infection:
BCE33L1051 may help B. cereus resist host defense mechanisms such as antimicrobial peptides, pH changes, or oxidative stress. These resistance mechanisms are often critical virulence determinants in foodborne pathogens .

Biofilm Formation:
If BCE33L1051 participates in cell envelope maintenance or intercellular communication, it could influence biofilm formation – a key virulence trait that enhances B. cereus persistence in hosts and the environment.

Potential as Therapeutic Target:
If BCE33L1051 proves essential for pathogenicity, it could represent a novel target for antimicrobial development, particularly if it has unique features compared to host proteins or proteins in commensal bacteria .

What methodological advances would facilitate better characterization of proteins like BCE33L1051?

Advancing our understanding of BCE33L1051 and similar proteins would benefit from several methodological improvements:

Improved Membrane Protein Techniques:

• Development of better detergents or membrane mimetics for maintaining native protein conformation

• Adaptation of nanodiscs or lipid cubic phase technologies specifically for bacterial membrane proteins

• Improved crystallization methods for membrane proteins from Gram-positive bacteria

Advanced Imaging Technologies:

• Super-resolution microscopy techniques optimized for bacterial cells

• Correlative light and electron microscopy (CLEM) protocols for B. cereus

• Cryo-electron tomography methods to visualize membrane proteins in their native context

Genetic Engineering Advances:

• More efficient CRISPR-Cas9 systems optimized for B. cereus

• Improved inducible gene expression systems for controlled expression

• Development of cell-specific conditional knockout systems

• Better reporter systems for real-time monitoring of protein expression and localization

Computational Method Improvements:

• Better prediction algorithms for membrane protein structures

• Enhanced molecular dynamics simulations that accurately represent bacterial membranes

• Machine learning approaches integrating multiple data types to predict protein function

• Improved comparative genomics tools for analyzing proteins across the B. cereus group

Screening Technologies:

• High-throughput phenotypic screens specific for membrane protein functions

• Improved protein-ligand binding detection methods

• Label-free technologies for monitoring protein-protein interactions in native membranes

These methodological advances would collectively accelerate research not only on BCE33L1051 but on the broader class of poorly characterized bacterial membrane proteins.

What are the key takeaways for researchers beginning work with BCE33L1051?

Researchers embarking on BCE33L1051 studies should consider these essential points to guide their work:

• Protein characteristics: BCE33L1051 is a 120-amino acid membrane protein belonging to the UPF0344 family with multiple predicted transmembrane domains, suggesting potential roles in transport, signaling, or membrane integrity .

• Expression and purification: Recombinant BCE33L1051 can be successfully expressed in E. coli with an N-terminal His tag, with optimization of purification protocols being critical for maintaining protein functionality .

• Handling considerations: This protein requires careful storage, reconstitution, and handling to maintain stability and activity, with particular attention to buffer composition and storage temperature .

• Functional hypotheses: While the precise function remains uncharacterized, comparative analysis with other B. cereus proteins and homologs in related species provides starting points for functional investigations .

• Methodological approach: A multi-faceted approach combining structural studies, genetic manipulation, and biochemical characterization offers the best strategy for elucidating BCE33L1051 function .

• Research context: Consider BCE33L1051 in the broader context of B. cereus biology, including potential roles in pathogenicity, stress response, or environmental adaptation .

• Technical challenges: Be prepared to address common challenges associated with membrane protein research, including solubility issues, purification difficulties, and functional assay development .

Researchers should approach BCE33L1051 with well-designed experiments that include appropriate controls and validation steps, while remaining open to unexpected findings that may reveal novel aspects of B. cereus biology.

How does current knowledge of BCE33L1051 fit into the broader understanding of B. cereus biology?

BCE33L1051 represents an intriguing but incompletely characterized component of B. cereus biology that connects to several important aspects of this organism's lifecycle and pathogenicity:

• Membrane biology: As a membrane protein, BCE33L1051 is part of the critical interface between B. cereus and its environment, potentially participating in sensing or responding to environmental conditions .

• Genomic context: While not directly identified as a virulence factor, BCE33L1051 exists in a species with complex virulence mechanisms including enterotoxins and emetic toxins, suggesting potential direct or indirect roles in pathogenicity .

• Evolutionary conservation: The presence of BCE33L1051 homologs across the B. cereus group (including B. anthracis and B. thuringiensis) indicates functional importance, while variations may reflect adaptation to different ecological niches .

• Knowledge gaps: BCE33L1051 exemplifies the significant number of hypothetical or poorly characterized proteins in bacterial genomes that may have important but as-yet-undiscovered functions in bacterial physiology or pathogenicity .

• Research opportunities: Studying BCE33L1051 offers opportunities to develop improved methods for characterizing bacterial membrane proteins and for understanding the functional diversity of the B. cereus group .