Recombinant Bacillus cereus UPF0344 protein BCG9842_B4136 (BCG9842_B4136)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a guideline.
Shelf Life
Shelf life depends on several factors: storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
Note: Tag type is determined during production. To request a specific tag, please inform us, and we will prioritize its development.
Synonyms
BCG9842_B4136; UPF0344 protein BCG9842_B4136
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-121
Protein Length
full length protein
Species
Bacillus cereus (strain G9842)
Target Names
BCG9842_B4136
Target Protein Sequence
MVHMHITAWALGLILFFVAYSLYSAGRKGKGVHMGLRLMYIIIIVTGFMLYMSIVKTATG SMHMWYGLKMLTGILVIGGMEMVLVKMSKNKPTGAVWGLFIVALVAVFYLGLKLPIGWKV F
Uniprot No.

Target Background

Database Links
Protein Families
UPF0344 family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is the predicted function of Bacillus cereus UPF0344 protein BCG9842_B4136?

The UPF0344 protein family remains largely uncharacterized, with functions primarily inferred through computational analysis. While specific function of BCG9842_B4136 has not been fully elucidated, researchers typically approach functional prediction through multiple methods:

  • Sequence homology analysis: Comparing the protein sequence with known proteins in databases such as UniProt and NCBI

  • Structural prediction: Using tools like AlphaFold2 to predict three-dimensional structure

  • Conserved domain identification: Analyzing conserved regions that may indicate functional roles

  • Genomic context: Examining adjacent genes that may be functionally related

For recombinant expression studies, researchers should consider that unlike characterized B. cereus toxins such as hemolysin BL (HBL), the function of UPF0344 proteins may not directly relate to virulence or inflammasome activation .

What expression systems are most suitable for recombinant BCG9842_B4136 production?

The optimal expression system for recombinant BCG9842_B4136 depends on research objectives and experimental requirements. Based on established protocols for similar bacterial proteins:

  • E. coli expression systems: Most commonly used due to:

    • High yield potential (typically 10-100 mg/L culture)

    • Rapid growth and expression (24-48 hours from transformation to purification)

    • Compatibility with pET vectors (particularly pET21b)

    • Established protocols for 15N-labeling for NMR studies

  • Expression optimization strategies:

    • BL21 Star (DE3) strain selection for enhanced mRNA stability

    • Induction with IPTG at OD600 of 0.6-0.8

    • Expression temperature adjustment (18-30°C) to improve folding

    • Codon optimization for E. coli if necessary

For structural and functional studies, E. coli BL21 Star (DE3) with pET21b vectors has demonstrated success for other bacterial proteins, with expression in minimal media enabling isotopic labeling for NMR characterization .

What purification approach yields the highest purity for structural studies?

Multi-step purification strategies are essential for obtaining high-purity recombinant BCG9842_B4136 for structural studies:

Purification StageMethodBuffer CompositionExpected Results
Primary CaptureNi-NTA affinity chromatography50 mM Tris-HCl (pH 8.0), 500 mM NaCl, 5 mM imidazole (binding); 250-500 mM imidazole (elution)>80% purity, removal of most host proteins
Intermediate PurificationSize-exclusion chromatography20 mM phosphate buffer (pH 6.8), 150 mM NaCl>95% purity, removal of aggregates and contaminating proteins
PolishingIon-exchange chromatography20 mM Tris-HCl (pH 8.0), 0-500 mM NaCl gradient>99% purity required for structural studies

For NMR studies, researchers should consider:

  • Buffer exchange to 20 mM sodium phosphate (pH 6.8), 50 mM NaCl, 5 mM DTT, 0.02% NaN3

  • Concentration to 200-700 μM using centrifugal concentrators

  • Assessment of sample homogeneity using SEC-MALS prior to structural studies

How does BCG9842_B4136 compare structurally with other characterized B. cereus proteins?

While specific structural data for BCG9842_B4136 remains limited, researchers can apply contemporary structural biology approaches to elucidate its structure:

  • Computational structure prediction:

    • AlphaFold2 prediction can provide an initial structural model with reasonable accuracy

    • Assessment against known B. cereus protein structures for domain organization comparison

  • Experimental structure determination:

    • NMR spectroscopy protocols similar to those used for novel αβ-protein folds:

      • 2D 1H-15N HSQC for initial assessment of folding

      • 3D triple-resonance experiments (HNCO, HN(CO)CACB, HNCACB) for backbone assignments

      • RDC measurements for refinement of structural models

  • Structural comparison metrics:

    • RMSD calculations against known B. cereus protein structures

    • Secondary structure composition analysis

    • Identification of potential binding pockets or active sites

Unlike well-characterized B. cereus toxins such as hemolysin BL (HBL) which has three subunits forming a pore complex , UPF0344 family proteins likely have distinct structural features that may inform their functional roles.

What experimental approaches can determine if BCG9842_B4136 interacts with the host immune system?

Given B. cereus' known interactions with host immune components, researchers can investigate potential immunomodulatory roles of BCG9842_B4136:

  • In vitro immune cell assays:

    • Stimulation of LPS-primed bone marrow-derived macrophages (BMDMs) with purified recombinant protein

    • Assessment of inflammasome activation markers:

      • Caspase-1 cleavage and activation by western blot

      • IL-1β and IL-18 release measurement by ELISA

      • Cell death assessment using LDH release assays

  • Inflammasome component dependency studies:

    • Comparative analysis using wild-type and knockout cell lines (NLRP3-/-, ASC-/-, NLRC4-/-, AIM2-/-, Casp11-/-)

    • Assessment of inflammasome-independent cytokine production (TNF, KC/CXCL1)

  • Mechanistic investigations:

    • Potassium efflux measurement to assess pore formation capability

    • ASC speck formation visualization using fluorescence microscopy

    • Assessment of signaling pathway activation (NF-κB, MAPK)

The experimental framework established for HBL toxin provides a methodological template, though BCG9842_B4136 may exhibit distinct immunological effects compared to characterized virulence factors .

What are the challenges in de novo structural prediction of BCG9842_B4136 and how can they be addressed?

Structural prediction of uncharacterized proteins like BCG9842_B4136 presents several challenges:

  • Challenges in computational prediction:

    • Limited homology to characterized proteins

    • Potential for novel folds not represented in training datasets

    • Difficulties in predicting multi-domain protein interactions

    • Uncertainty in predicting disorder regions

  • Strategies for improving prediction accuracy:

    • Integration of multiple prediction methods (AlphaFold2, RosettaFold)

    • Refinement using local sequence-structure compatibility analysis

      • Collection of 200 fragments for each nine-residue frame based on sequence similarity

      • Calculation of Cα RMSD of local structure against each fragment

      • Selection of models with high log-ratio of fragments with RMSD < 1.5 Å

    • Energy landscape evaluation using RosettaDesign calculations

      • Filtering based on total energy, RosettaHoles score < 2.0

      • Packstat score > 0.55-0.6 for structural stability assessment

  • Experimental validation approaches:

    • Circular dichroism (CD) spectroscopy for secondary structure verification

    • NMR spectroscopy for tertiary structure confirmation

    • Limited proteolysis to identify domain boundaries and stable fragments

The methodological approaches used for novel αβ-protein fold characterization provide valuable frameworks for addressing these challenges .

What strategies can overcome expression and solubility issues for recombinant BCG9842_B4136?

Expression of recombinant UPF0344 proteins may present solubility challenges requiring systematic optimization:

ChallengeOptimization StrategyExpected Outcome
Poor expressionTest multiple E. coli strains (BL21, Rosetta, SHuffle)Identify optimal host for expression
Optimize codon usage for E. coliImprove translation efficiency
Test different promoter systems (T7, tac, ara)Identify optimal transcriptional control
Insoluble expressionLower induction temperature (16-25°C)Reduce inclusion body formation
Co-express with molecular chaperones (GroEL/ES, DnaK)Improve folding efficiency
Use solubility-enhancing fusion tags (SUMO, MBP, TrxA)Increase soluble fraction
Protein instabilityBuffer optimization (pH 6.5-8.0, salt 50-300 mM)Identify stabilizing conditions
Add stabilizing additives (glycerol, arginine, trehalose)Prevent aggregation
Identify minimal stable domains using limited proteolysisFocus on expressible domains

Based on experience with other bacterial proteins, success rates for expressing soluble proteins can be as high as 56 out of 60 designed proteins when appropriate expression and purification strategies are employed .

How can researchers distinguish between specific and non-specific immunological effects of BCG9842_B4136?

When investigating potential immunomodulatory effects of recombinant BCG9842_B4136, researchers must employ rigorous controls:

  • Essential experimental controls:

    • Endotoxin removal validation using LAL assay (acceptable level <0.1 EU/mg)

    • Heat-inactivated protein control to distinguish between effects dependent on protein structure

    • Empty vector-expressed and purified control to account for host cell contaminants

    • Known B. cereus immunomodulatory proteins (e.g., HBL) as positive controls

  • Comparative analysis with knockout systems:

    • Wild-type vs. NLRP3-/- cellular systems to assess inflammasome dependence

    • Pharmacological inhibitors (e.g., MCC950 for NLRP3) to validate genetic findings

    • Assessment of inflammasome-independent cytokines (TNF, KC/CXCL1) to confirm specificity

  • Methodological approaches for validation:

    • Complementary techniques (Western blot, ELISA, qPCR) for cytokine measurements

    • Dose-response relationships to establish biological relevance

    • Time-course experiments to determine kinetics of effects

    • Neutralizing antibodies against the protein to confirm specificity

These approaches parallel those used to establish HBL as an NLRP3 inflammasome activator, distinguishing it from other B. cereus factors like NHE and Cytotoxin K .

What NMR experiments are most informative for structural characterization of BCG9842_B4136?

NMR spectroscopy offers powerful approaches for structural characterization of recombinant BCG9842_B4136:

  • Initial assessment experiments:

    • 2D 1H-15N HSQC (echo/anti-echo) to evaluate protein folding and stability

    • 1H-13C Constant-Time HSQC for aliphatic and aromatic signals

    • Optimization of experimental conditions:

      • Temperature (typically 303K)

      • pH (6.5-7.5)

      • Protein concentration (200-700 μM)

  • Backbone and side-chain assignment experiments:

    • 3D HNCO, HN(CO)CACB, and HNCACB for backbone assignments

    • BEST pulse sequence application for improved sensitivity

    • 3D HCCH-TOCSY and 13C-edited NOESY for side-chain assignments

  • Structural restraint collection:

    • NOE-based distance restraints from 15N-edited and 13C-edited NOESY experiments

    • Dihedral angle restraints from chemical shift analysis using TALOS-N

    • Residual dipolar coupling (RDC) measurements using aligned media

Typical experimental parameters include:

  • Protein concentration: 200-700 μM in 20 mM sodium phosphate buffer (pH 6.8)

  • NMR spectrometers: 600-950 MHz with cryogenic probes

  • Acquisition temperature: 303K

  • Total experiment time: 1-2 weeks for complete dataset collection

How might BCG9842_B4136 contribute to B. cereus pathogenicity?

Understanding the potential role of BCG9842_B4136 in pathogenicity requires integrating multiple investigative approaches:

  • Comparative genomics approaches:

    • Analysis of gene presence/absence across pathogenic and non-pathogenic B. cereus strains

    • Evaluation of genetic conservation versus variation across clinical isolates

    • Assessment of protein expression during infection using transcriptomics/proteomics

  • Functional studies in infection models:

    • Generation of gene knockout strains and complementation studies

    • Comparison with known virulence factor knockouts (e.g., ΔHbl B. cereus)

    • Assessment of bacterial fitness, growth, and host interaction

  • Host-pathogen interaction studies:

    • Evaluation of protein's effects on host cell viability and function

    • Assessment of inflammatory responses using methods established for HBL toxin

    • Investigation of potential interactions with host proteins through pull-down assays

Current research indicates that B. cereus pathogenicity involves multiple factors, with proteins like HBL activating the NLRP3 inflammasome through pore formation and potassium efflux . The investigation of BCG9842_B4136 should be contextualized within this broader understanding of B. cereus virulence mechanisms.

What potential applications exist for BCG9842_B4136 in structural biology research?

The structural characterization of BCG9842_B4136 offers several potential applications in structural biology:

  • Novel fold identification and classification:

    • Contribution to protein fold databases for improved structure prediction

    • Identification of potentially novel structural motifs or domains

    • Application of de novo protein design principles for structure validation

  • Structure-function relationship studies:

    • Correlation between structural features and functional properties

    • Identification of potential binding sites or catalytic regions

    • Structure-guided mutagenesis to test functional hypotheses

  • Methodological advancements:

    • Testing and refinement of computational structure prediction tools like AlphaFold2

    • Development of improved protocols for expressing and purifying challenging proteins

    • Advancement of NMR methods for structural characterization of bacterial proteins

The experimental approaches used for novel protein fold characterization, including computational design, expression optimization, and NMR structure determination, provide valuable methodological frameworks for this research .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.