Recombinant Bacillus cereus UPF0344 protein BCQ_1212 (BCQ_1212)

Shipped with Ice Packs
In Stock
Cat. No.
BT2478972
Source
in vitro E.coli expression system
Synonyms
BCQ_1212; UPF0344 protein BCQ_1212
Quick Inquiry

Description

Overview of Recombinant Bacillus cereus UPF0344 Protein BCQ_1212 (BCQ_1212)

Recombinant Bacillus cereus UPF0344 protein BCQ_1212 (BCQ_1212) is a protein that is produced using recombinant DNA technology . This protein, also known as UPF0344 protein BCQ_1212, is derived from the bacterium Bacillus cereus . Bacillus cereus is a Gram-positive, facultatively anaerobic, toxin-producing bacterium commonly found in various environments such as soil, vegetation, and food .

Basic Information

FeatureDescription
Gene NameBCQ_1212
SynonymsBCQ_1212, UPF0344 protein BCQ_1212
UniProt IDB9ITG0
SourceE. coli
TagHis (N-terminal)
Protein LengthFull Length (1-120 amino acids)
AA SequenceMVHMHITAWALGLILFFVAYSLYSAGRKGKGVHMGLRLMYIIIIVTGVWLYLDQTIVDKS YHMWYGLKMLAGILVIAGMEMVLVKMSKNKATGAFWGLFIIALVAVFYLGLKLPIGWQVF
PurityGreater than 90% as determined by SDS-PAGE
FormLyophilized powder
StorageStore at -20°C/-80°C upon receipt, aliquoting is necessary for multiple use. Avoid repeated freeze-thaw cycles .
Storage BufferTris/PBS-based buffer, 6% Trehalose, pH 8.0 or Tris-based buffer, 50% glycerol
ReconstitutionReconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. Add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃ .

Production and Characteristics

The recombinant protein is produced in E. coli and includes a His-tag, typically located at the N-terminus, which facilitates purification using affinity chromatography . The protein consists of 120 amino acids and has a molecular weight of 13.4 kDa . The purity of the protein is guaranteed to be greater than 90%, as determined by SDS-PAGE, ensuring that the preparation is highly enriched for the target protein .

Function and Significance

The function of the UPF0344 protein BCQ_1212 is not yet clearly defined, it is annotated as a protein of unknown function (UPF) . Proteins in this category lack functional annotation based on experimental evidence and are identified through bioinformatics analysis . Further research, like structural and functional studies, may provide insights into the role of BCQ_1212 in Bacillus cereus . Understanding its function could potentially reveal its involvement in bacterial processes or interactions within its environment .

Applications

Recombinant Bacillus cereus UPF0344 protein BCQ_1212 is suitable for uses such as ELISA. It can be employed in antibody production, and as a control or standard in various analytical assays .

Product Specs

Form
Lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs unless dry ice shipping is specifically requested in advance. Additional fees apply for dry ice shipping.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to settle the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and may serve as a guideline.
Shelf Life
Shelf life depends on several factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.
Note: Tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
BCQ_1212; UPF0344 protein BCQ_1212
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-120
Protein Length
full length protein
Species
Bacillus cereus (strain Q1)
Target Names
BCQ_1212
Target Protein Sequence
MVHMHITAWALGLILFFVAYSLYSAGRKGKGVHMGLRLMYIIIIVTGVWLYLDQTIVDKS YHMWYGLKMLAGILVIAGMEMVLVKMSKNKATGAFWGLFIIALVAVFYLGLKLPIGWQVF
Uniprot No.
B9ITG0

Target Background

Database Links

KEGG: bcq:BCQ_1212

Protein Families
UPF0344 family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *

Category

Service

THE BIOTEK
THE BioTek is a global biotech company offering highly purified proteins for research in cancer, apoptosis, development, endocrinology, immunology, neuroscience, proteases, and stem cells.
  • Contact
  • Address: 1925 E Maple Ave, El Segundo, CA 90245 United States
  • Phone : +1 201-285-7826
  • Email : info@thebiotek.com
  • Hours : Mon.-Fri. 9:00 AM - 5:00 PM
© Copyright 2025 TheBiotek. All Rights Reserved.