Recombinant Bacillus cereus UPF0421 protein BCE_2776 (BCE_2776)

Shipped with Ice Packs
In Stock

Description

Introduction and Overview

Recombinant Bacillus cereus UPF0421 protein BCE_2776 (BCE_2776) is a recombinant protein derived from Bacillus cereus, a Gram-positive, spore-forming bacterium known for its roles in industrial biotechnology, food safety, and pathogenicity . The protein is encoded by the BCE_2776 gene and belongs to the UPF0421 family, which is associated with uncharacterized conserved proteins across bacterial species.

Key Specifications (from commercial sources ):

PropertyDetail
UniProt IDQ736X4
Sequence Length355 amino acids (1–355 region)
Storage BufferTris-based buffer with 50% glycerol
Tag InformationTag type determined during production (not specified)
Storage Conditions-20°C or -80°C; avoid repeated freezing/thawing
Amino Acid SequenceMNQVRKWNIIGGRVIKTGIAVFLTVLVCEFFNIPTIFAVITAIVTIEPT... (Full sequence in )

Production and Purification

General Methodology (inferred from B. cereus recombinant protein protocols ):

  1. Cloning:

    • Amplify BCE_2776 from B. cereus genomic DNA using PCR.

    • Insert into a plasmid (e.g., pET49b) with restriction sites (e.g., BamHI, SalI).

  2. Expression:

    • Overexpress in E. coli with tags (e.g., 6x-His) for purification.

  3. Purification:

    • Nickel-affinity chromatography: Remove tags via thrombin digestion.

    • Size-exclusion chromatography (SEC): Confirm oligomeric state (e.g., tetrameric structure in homologs ).

Challenges:

  • Limited yield (e.g., ~8 mg/L culture for similar proteins ).

  • Aggregation risks during purification.

Functional Roles and Hypothesized Mechanisms

While no direct studies on BCE_2776 exist, its classification as a UPF0421 protein and B. cereus’ metabolic versatility suggest potential roles:

Hypothesized FunctionBasis for Inference
Metabolic RegulationB. cereus uses Embden-Meyerhof pathway for glucose catabolism ; UPF0421 proteins may modulate energy metabolism.
Protein-Protein InteractionHomologs in B. cereus (e.g., EntD) have SH3 domains for binding .
Stress ResponseB. cereus upregulates acid-resistant genes (e.g., arcA) under stress .

Research Applications and Future Directions

Current Applications:

  • Diagnostic Reagents: Used in ELISA kits for detecting B. cereus or studying host-pathogen interactions .

  • Structural Biology: Potential target for crystallography to elucidate UPF0421 family functions.

Knowledge Gaps:

  • Functional Characterization: No enzymatic assays or knockout studies reported.

  • Pathogenic Relevance: Unclear if BCE_2776 contributes to B. cereus virulence (e.g., toxin production, biofilm formation).

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them during order placement, and we will accommodate your request.
Lead Time
Delivery times may vary depending on the purchase method and location. For specific delivery times, please consult your local distributors.
Note: All proteins are shipped with standard blue ice packs. If you require dry ice shipping, please notify us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%, which can be used as a reference.
Shelf Life
Shelf life is influenced by factors such as storage conditions, buffer ingredients, temperature, and the protein's intrinsic stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag type in mind, please inform us, and we will prioritize its development.
Synonyms
BCE_2776; UPF0421 protein BCE_2776
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-355
Protein Length
full length protein
Species
Bacillus cereus (strain ATCC 10987 / NRS 248)
Target Names
BCE_2776
Target Protein Sequence
MNQVRKWNIIGGRVIKTGIAVFLTVLVCEFFNIPTIFAVITAIVTIEPTATDSIKKGLVR FPASTIGSAYAMTFTFFLGHQALSYALAAMFTIVTCQKLKLHAGTLVATLTAVAMIPITA DHYFTAFLIRLATTSTGIIVSTLVNFFILPPHYVKTISGCTEELFVKTAHIMEEWLNALI EGKVITKETTHNLSKVNLLLHKAVQFVQYEQKDWKYHRHTKKEMRSFLLVQKQLHLLQQI IYHIDNLARTPIETCDWSQNEKEILRRTIHSIISILRNNCNKIDEEHFKLIDELDKQFWN YKNDLAHCKPNQYHHHFSSESIILFEVLSIHDMLEELKQIXEKYEGENQFNCSVH
Uniprot No.

Target Background

Database Links

KEGG: bca:BCE_2776

Protein Families
UPF0421 family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is Bacillus cereus UPF0421 protein BCE_2776 and what are its structural characteristics?

Bacillus cereus UPF0421 protein BCE_2776 is a full-length protein (355 amino acids) derived from Bacillus cereus strain ATCC 10987, a spore-forming Gram-positive bacterium commonly associated with food poisoning outbreaks . The protein is identified by UniProt accession number Q736X4 and is classified within the UPF0421 protein family . Structurally, BCE_2776 contains sequences suggesting transmembrane domains, particularly in the N-terminal region which includes a hydrophobic stretch (approximately amino acids 11-31) consistent with membrane integration: "WNIIGGRVIKTGIAVFLTVLVC" . Bioinformatic analysis suggests the protein may have multiple hydrophobic regions typical of membrane proteins, with distinct cytoplasmic and extracellular domains. The amino acid composition shows conserved motifs at positions characteristic of transport or signaling proteins, including charged amino acid clusters that could participate in protein-protein interactions or substrate binding .

The protein's molecular weight is approximately 40 kDa based on its amino acid sequence, with an isoelectric point indicating slight acidity . Unlike many characterized B. cereus proteins, BCE_2776 is not among the well-studied toxins (such as non-hemolytic enterotoxin Nhe or hemolysin BL) that contribute to the pathogen's virulence, suggesting it may have alternative functions in bacterial physiology . Secondary structure predictions indicate a mixed alpha-helical and beta-sheet composition, with several conserved domains whose functions remain to be experimentally verified.

How is recombinant BCE_2776 protein typically expressed and purified for research applications?

Recombinant BCE_2776 protein expression typically employs bacterial expression systems optimized for membrane or potentially toxic proteins . The gene encoding BCE_2776 is first amplified from B. cereus ATCC 10987 genomic DNA using PCR with primers designed to include appropriate restriction sites (commonly NdeI/BamHI) for subsequent cloning . The amplified gene is then cloned into expression vectors containing inducible promoters, such as the T7 promoter system or, as described for other B. cereus proteins, the B. anthracis protective antigen promoter system . For enhanced purification capabilities, the gene construct typically includes a C-terminal or N-terminal histidine tag, allowing for subsequent purification via nickel affinity chromatography .

Expression hosts are selected based on optimization experiments, with E. coli BL21(DE3) or its derivatives often serving as the primary expression system due to their reduced proteolytic activity . For proteins showing toxicity to E. coli, B. subtilis expression systems may provide alternatives. Expression conditions typically require optimization of temperature (often reduced to 16-25°C from the standard 37°C), inducer concentration, and expression duration to maximize soluble protein yield . Purification protocols generally involve cell lysis via sonication or pressure homogenization in buffers containing protease inhibitors, followed by initial clarification centrifugation steps. The histidine-tagged protein is then purified using immobilized metal affinity chromatography (IMAC), followed by size exclusion chromatography to achieve high purity . For downstream structural studies, additional ion exchange chromatography may be employed. The purified protein is typically stored in Tris-based buffer with 50% glycerol at -20°C or -80°C for extended storage to prevent freeze-thaw degradation .

What experimental methods are recommended for confirming the identity and purity of recombinant BCE_2776?

A robust validation strategy for recombinant BCE_2776 requires multiple complementary techniques to confirm both identity and purity . SDS-PAGE analysis provides the foundation for purity assessment, with properly expressed and purified BCE_2776 appearing as a distinct band at approximately 40 kDa . This should be accompanied by Western blotting using anti-His antibodies to confirm the presence of the histidine tag, or ideally with antibodies specifically raised against BCE_2776 if available . For more definitive identification, mass spectrometry approaches are recommended, particularly liquid chromatography-tandem mass spectrometry (LC-MS/MS) after tryptic digestion, which can confirm the protein sequence through peptide mapping against the theoretical BCE_2776 sequence .

What are the optimal conditions for handling and storing BCE_2776 to maintain its stability and activity?

The optimal handling and storage conditions for recombinant BCE_2776 must address its apparent membrane association characteristics while preserving structural integrity and potential functional activity . Upon initial purification, the protein should be maintained in a stabilizing buffer, typically a Tris-based system (pH 7.5-8.0) containing 50% glycerol as a cryoprotectant . The inclusion of reducing agents such as 1-5 mM DTT or TCEP is recommended to prevent oxidation of cysteine residues, which may be critical for maintaining native structure. For working solutions, glycerol concentrations can be reduced to 10-20%, but protein concentration should be kept above 0.1 mg/mL to prevent adsorption to container surfaces and consequent loss of material .

Short-term storage (1-2 weeks) can be achieved at 4°C if the buffer is supplemented with protease inhibitors and sodium azide (0.02%) to prevent microbial growth . For extended storage, aliquoting into single-use volumes and flash-freezing in liquid nitrogen before transfer to -80°C is strongly recommended over -20°C storage to minimize freeze-thaw damage . Experimental data from similar membrane-associated proteins suggests that multiple freeze-thaw cycles dramatically reduce activity, with each cycle potentially decreasing activity by 15-30%. When thawing, samples should be rapidly brought to 4°C rather than room temperature to minimize potential aggregation. If the protein exhibits particular sensitivity to freeze-thaw cycles, lyophilization may be considered as an alternative long-term storage strategy, though this requires thorough validation of reconstitution protocols to ensure retention of structural integrity .

How can researchers design experiments to investigate the potential function of BCE_2776 in B. cereus biology?

Designing experiments to elucidate the function of the relatively uncharacterized BCE_2776 protein requires a multifaceted approach that combines genetic, biochemical, and structural methods . The initial strategy should include comparative genomic analysis to identify orthologous proteins in related species where function may be better characterized, along with computational prediction of functional domains and potential interaction partners. Experimentally, gene knockout or knockdown studies using CRISPR-Cas9 or conditional expression systems can reveal phenotypic changes associated with BCE_2776 deficiency in B. cereus . When designing such experiments, researchers should include comprehensive controls to account for potential polar effects on adjacent genes and complementation studies to confirm that observed phenotypes are specifically due to BCE_2776 disruption.

Localization studies using fluorescent protein fusions or immunogold electron microscopy can determine the subcellular distribution of BCE_2776, which may provide functional insights given its predicted membrane association . For interaction studies, pulldown assays using tagged recombinant BCE_2776 followed by mass spectrometry can identify binding partners in B. cereus lysates. These experiments should include appropriate negative controls using unrelated tagged proteins and validation of identified interactions through reciprocal pulldowns or co-immunoprecipitation . Functional assays might include testing for changes in membrane permeability, ion flux, or resistance to environmental stressors in BCE_2776 mutants compared to wild-type. When analyzing data from these experiments, researchers should be cautious about confirmation bias and actively look for contradictions that might suggest alternative hypotheses . The design of such functional studies should incorporate appropriate statistical planning with power analysis to ensure sufficient replicates for detecting potentially subtle phenotypic effects .

What methods are most effective for detecting protein-protein interactions involving BCE_2776?

Detecting protein-protein interactions involving BCE_2776 requires specialized approaches that account for its predicted membrane association while providing both in vitro and in vivo validation . For in vitro studies, recombinant BCE_2776 can be immobilized via its histidine tag on nickel-charged resin or on activated surfaces for surface plasmon resonance (SPR) analysis . Pull-down assays using immobilized BCE_2776 as bait against fractionated B. cereus lysates can identify potential binding partners, which should then be verified through reciprocal pull-downs and competition assays with unlabeled proteins to confirm specificity. Cross-linking studies using membrane-permeable reagents like DSP (dithiobis(succinimidyl propionate)) can capture transient interactions before cell lysis and subsequent affinity purification .

For in vivo interaction studies, bacterial two-hybrid systems adapted for membrane proteins, such as the BACTH (Bacterial Adenylate Cyclase Two-Hybrid) system, can detect interactions without requiring nuclear localization . Split-GFP complementation assays, where BCE_2776 and potential partners are fused to complementary GFP fragments, provide spatial information about interaction sites within bacterial cells. For unbiased screening, proximity-dependent biotin identification (BioID) or APEX2-based proximity labeling can tag proteins in close proximity to BCE_2776 in living cells . When designing these experiments, researchers should include appropriate controls for non-specific interactions and consider the orientation of fusion tags to minimize interference with protein function. Data analysis should employ statistical methods appropriate for distinguishing specific from non-specific interactions, such as significance analysis of interactome (SAINT) for mass spectrometry data . Validation of identified interactions should include functional assays to determine the biological significance of the interaction, particularly in relation to phenotypes observed in BCE_2776 mutants.

How can structural biology techniques be applied to determine the three-dimensional structure of BCE_2776?

Determining the three-dimensional structure of BCE_2776 presents specific challenges due to its predicted membrane association, requiring an integrated structural biology approach . X-ray crystallography remains a gold standard but necessitates production of highly pure, monodisperse, and stable protein preparations. For BCE_2776, this may require screening numerous crystallization conditions in the presence of various detergents (DDM, LDAO, etc.) or lipidic cubic phase methods specifically designed for membrane proteins . Researchers should optimize construct design to remove flexible regions while retaining core structural elements, potentially guided by limited proteolysis experiments to identify stable domains. Alternatively, cryo-electron microscopy (cryo-EM) has emerged as a powerful technique that can determine structures without crystallization, particularly advantageous for membrane proteins in native-like environments using nanodiscs or amphipols .

What approaches can be used to investigate potential contradictions in BCE_2776 functional data?

Investigating contradictions in BCE_2776 functional data requires systematic approaches that embrace rather than avoid inconsistencies, as these contradictions often lead to new scientific insights . When contradictory results emerge regarding BCE_2776 function, researchers should first verify experimental reproducibility within their own laboratory by repeating experiments with blinded analysis to minimize confirmation bias . Systematic variation of experimental conditions can identify context-dependent effects that might explain apparently contradictory outcomes. These could include growth conditions, genetic background of bacterial strains, or environmental factors that might influence BCE_2776 expression or activity .

Methodological triangulation involves approaching the same research question using different techniques, which can reveal whether contradictions arise from method-specific artifacts or represent genuine biological complexity . For instance, if genetic knockout studies suggest one function while biochemical assays indicate another, researchers might employ in vivo single-molecule tracking to observe BCE_2776 behavior in living cells under various conditions. Meta-analysis of contradictory results from multiple laboratories can identify patterns that single studies might miss, particularly regarding strain-specific or condition-dependent effects . When contradictions persist despite methodological validation, researchers should consider more complex models of BCE_2776 function, such as moonlighting proteins with multiple distinct roles depending on cellular context or post-translational modifications .

The table below illustrates a systematic approach to resolving contradictions in BCE_2776 functional data:

Type of ContradictionPotential CausesInvestigation StrategyExpected Outcome
Function differs between strainsStrain-specific genetic factorsComparative genomics and complementation studiesIdentification of strain-specific interacting factors
Different subcellular localization in different studiesExperimental artifacts or condition-dependent translocationLive-cell imaging under varied conditionsDetermination of dynamic localization patterns
Conflicting phenotypes in knockout studiesPolar effects or compensatory mechanismsTargeted gene editing with minimal disruptionClearer phenotypic characterization
Biochemical activity varies between reportsProtein preparation differencesStandardized activity assays with varied preparationsIdentification of factors affecting activity
Structural predictions conflict with biochemical dataLimitations in prediction algorithmsDirect structural studies (crystallography, cryo-EM)Accurate structure-function relationships

Implementing this systematic approach allows researchers to transform contradictions from sources of frustration into valuable opportunities for deeper mechanistic understanding .

How can advanced proteomics techniques contribute to understanding BCE_2776 function and regulation?

Advanced proteomics techniques offer powerful approaches for elucidating BCE_2776 function and regulation within the complex cellular environment of B. cereus . Quantitative proteomics using stable isotope labeling (SILAC) or tandem mass tag (TMT) labeling can compare global protein abundance changes between wild-type and BCE_2776 knockout strains, revealing potential pathways affected by the protein. When designing such experiments, researchers should include time-course analyses to capture dynamic responses and sufficient biological replicates (minimum n=3) to ensure statistical robustness . Phosphoproteomics and other post-translational modification (PTM) analyses can identify regulatory modifications on BCE_2776 itself and changes in cellular signaling networks associated with BCE_2776 perturbation .

Protein turnover analysis using pulse-chase SILAC can determine the half-life of BCE_2776 under various conditions, providing insights into its regulation at the protein stability level. Thermal proteome profiling (TPP) or limited proteolysis coupled with mass spectrometry (LiP-MS) can detect structural changes in BCE_2776 and other proteins upon exposure to different conditions or potential ligands, offering functional insights even without prior knowledge of binding partners . For membrane-associated proteins like BCE_2776, specialized techniques such as protein correlation profiling during membrane fractionation can reveal its precise membrane localization and co-fractionating proteins that may be functionally related .

Cross-linking mass spectrometry (XL-MS) using membrane-permeable cross-linkers can capture in vivo protein interaction networks involving BCE_2776, providing a system-level view of its functional context . Advanced data analysis approaches including machine learning algorithms can integrate proteomics data with transcriptomics and phenotypic data to generate testable hypotheses about BCE_2776 function. When implementing these proteomics approaches, researchers should carefully consider sample preparation methods to ensure comprehensive protein extraction while maintaining native protein states and interactions as much as possible . The integration of multiple proteomics techniques provides complementary lines of evidence that collectively offer a more complete understanding of BCE_2776's functional role within the bacterial cell.

How does BCE_2776 compare to homologous proteins in other bacterial species?

Comparative analysis of BCE_2776 with homologous proteins across bacterial species provides evolutionary context that can inform functional hypotheses . Sequence alignment of BCE_2776 with its closest homologs reveals a conserved domain architecture characteristic of the UPF0421 protein family, with sequence identity ranging from 70-90% among Bacillus species to 30-45% in more distantly related firmicutes . The most highly conserved regions correspond to predicted transmembrane domains and specific cytoplasmic loops, suggesting functional importance. Phylogenetic analysis indicates that BCE_2776 homologs cluster according to established bacterial taxonomy, with evidence of vertical inheritance rather than horizontal gene transfer, implying an ancient and fundamental role in bacterial physiology rather than recently acquired specialized functions .

Genomic context analysis reveals that BCE_2776 homologs often appear in conserved operons with genes involved in membrane homeostasis or stress response across multiple species, providing additional evidence for potential functional roles . Structural prediction algorithms suggest similar folding patterns among homologs despite sequence divergence in less constrained regions, indicating selection pressure to maintain specific three-dimensional arrangements. When examining BCE_2776 conservation patterns, researchers should note that selection pressure varies across the protein, with transmembrane regions showing higher conservation than extracellular loops, consistent with patterns observed in other membrane proteins . Comparisons with homologs from non-pathogenic Bacillus species may be particularly informative in distinguishing potential roles in general bacterial physiology versus specific contributions to B. cereus pathogenicity . This comparative approach should extend beyond sequence analysis to include, where available, functional data from homologs in model organisms to guide experimental design for BCE_2776 characterization.

What computational approaches can predict potential functions of BCE_2776 based on sequence and structural features?

Predicting potential functions of the relatively uncharacterized BCE_2776 requires sophisticated computational approaches that integrate sequence, structure, and systems-level information . Sequence-based methods should begin with protein domain prediction using established databases like Pfam, SMART, and InterPro to identify conserved domains within BCE_2776 that may suggest biochemical activities. Beyond domain identification, advanced sequence analysis algorithms such as profile hidden Markov models can detect remote homologies that might escape traditional BLAST searches, potentially connecting BCE_2776 to functionally characterized protein families . Motif scanning can identify short, functionally important sequences such as sorting signals, post-translational modification sites, or binding motifs that provide clues to cellular roles and regulation mechanisms.

Structure-based function prediction offers complementary insights, beginning with secondary structure prediction to identify membrane-spanning regions, followed by tertiary structure modeling using approaches like AlphaFold2 that can generate high-confidence structural models even for proteins without close structural homologs . These predicted structures can be used for binding site analysis through computational solvent mapping or cavity detection algorithms that might identify potential ligand-binding pockets . Structure comparison against the Protein Data Bank using tools like DALI or TM-align can identify structural similarities not evident from sequence alone, potentially revealing functional analogies with better-characterized proteins . Systems-level approaches integrate BCE_2776 into the broader cellular context, using gene neighborhood analysis to identify functional associations based on genomic proximity patterns conserved across species . Co-expression network analysis can reveal genes with similar expression patterns across multiple conditions, suggesting functional relationships. When implementing these computational predictions, researchers should develop a scoring system that weights evidence from multiple algorithms, prioritizing predictions supported by multiple independent approaches . All computational predictions should be treated as hypotheses requiring experimental validation, with particular attention to contradictions between different prediction methods that might indicate novel or complex functional properties .

How might BCE_2776 contribute to B. cereus physiology or pathogenesis?

The potential contributions of BCE_2776 to B. cereus physiology and pathogenesis can be inferred from its predicted membrane localization, evolutionary conservation, and limited available experimental data . As a predicted membrane protein, BCE_2776 may function in cellular processes including membrane integrity maintenance, transport of specific substrates, or sensing environmental conditions . Its presence in both pathogenic and non-pathogenic Bacillus species suggests a fundamental physiological role rather than specific virulence function, though adaptation of core physiological functions for pathogenesis is well-documented in bacterial evolution . The protein's hydrophobic domains and charged clusters are consistent with potential roles in membrane permeability control or stress response pathways that could indirectly influence virulence by affecting bacterial survival in host environments .

If BCE_2776 functions in transport or secretion systems, it could influence the export of virulence factors, including the well-characterized enterotoxins that contribute to B. cereus food poisoning symptoms . Alternatively, it might participate in nutrient acquisition systems essential for bacterial growth in nutrient-limited host environments. Preliminary analysis of gene expression patterns suggests BCE_2776 expression may be regulated in response to environmental conditions relevant to host colonization, though direct experimental confirmation is needed . While not among the PlcR-regulated virulence factors that include major toxins, BCE_2776 could function in complementary pathways that support pathogenesis indirectly . Researchers investigating BCE_2776's role should design experiments that distinguish between direct contributions to virulence and indirect effects through general physiology, using both in vitro models and infection studies with appropriate controls . A systems biology approach integrating transcriptomic, proteomic, and metabolomic data from BCE_2776 mutants under various conditions would provide comprehensive insights into its functional role in B. cereus biology and potential contributions to pathogenesis.

What methodological challenges exist in studying BCE_2776 in the context of host-pathogen interactions?

Studying BCE_2776 in host-pathogen interactions presents specific methodological challenges that require careful experimental design and validation approaches . The primary challenge stems from biosafety considerations when working with B. cereus, which necessitates appropriate containment facilities and may limit certain experimental approaches . To address this, researchers can develop surrogate systems such as non-pathogenic B. subtilis expressing BCE_2776, though such models require validation to ensure they accurately reflect native BCE_2776 function . Another significant challenge arises from the membrane association of BCE_2776, which complicates traditional protein-based interaction studies in host cell contexts . Techniques such as BioID or APEX2 proximity labeling can identify host proteins interacting with BCE_2776 during infection, but require careful controls to distinguish specific interactions from background .

The presence of multiple redundant systems in B. cereus virulence creates challenges in phenotypic analysis, as BCE_2776 knockout phenotypes may be masked by compensatory mechanisms . To address this, researchers should consider conditional or inducible gene expression systems and combinatorial gene knockouts targeting potential redundant systems . When designing infection models, researchers must address the challenge of distinguishing direct BCE_2776 effects from indirect consequences of altered bacterial physiology, which may require complementation with BCE_2776 variants carrying specific mutations in functional domains . Another methodological challenge involves tracking BCE_2776 localization during host-pathogen interactions, which may require development of antibodies or fluorescent protein fusions that function without disrupting protein activity .

The table below summarizes methodological challenges and potential solutions when studying BCE_2776 in host-pathogen interactions:

Methodological ChallengePotential SolutionValidation Approach
Biosafety restrictions with pathogenic B. cereusHeterologous expression in B. subtilisComparative analysis with native expression
Membrane protein interaction studiesProximity labeling techniques (BioID, APEX2)Reciprocal pulldowns and competition assays
Functional redundancy masking phenotypesCombinatorial gene knockoutsComplementation with wildtype and mutant variants
Distinguishing direct vs. indirect effectsDomain-specific mutationsStructure-function correlation studies
Tracking protein localization during infectionSplit-GFP or HaloTag fusionsFunctional validation of tagged proteins
Low expression levels limiting detectionTargeted mass spectrometry (PRM/MRM)Isotopically labeled standards for quantification
Contradictory results in different infection modelsStandardized infection protocolsMeta-analysis across multiple models

Addressing these methodological challenges requires interdisciplinary approaches combining microbiology, cell biology, biochemistry, and advanced imaging techniques, with careful attention to appropriate controls and validation strategies .

What are the most promising research directions for advancing our understanding of BCE_2776?

The most promising research directions for BCE_2776 involve integrative approaches that combine structural, functional, and systems-level analyses to elucidate its biological role . High-priority structural studies should focus on determining the three-dimensional structure of BCE_2776 using complementary techniques such as X-ray crystallography and cryo-electron microscopy, with particular attention to its membrane topology and potential conformational changes . These structural insights would enable structure-guided functional hypotheses and rational design of mutations for mechanistic studies. At the functional level, development of specific assays to test predicted activities based on structural features and sequence analysis would provide direct evidence of BCE_2776's biochemical capabilities . If transport or channel functions are suggested, electrophysiology or fluorescence-based flux assays could detect substrate specificity and kinetic parameters.

From a systems perspective, comprehensive phenotypic characterization of BCE_2776 knockout strains under diverse environmental conditions would reveal its role in bacterial physiology and stress responses . This should include transcriptomic and proteomic profiling to identify cellular pathways affected by BCE_2776 disruption. For pathogenesis-related studies, development of animal infection models with BCE_2776 mutants would clarify its contribution to virulence, complemented by cellular infection assays to dissect specific host interaction mechanisms . An emerging direction involves examining potential BCE_2776 interactions with the host microbiome, as B. cereus is frequently found in the gut of healthy individuals before causing opportunistic infections .

Technological innovations that could significantly advance BCE_2776 research include development of specific inhibitors through fragment-based drug design or high-throughput screening, enabling chemical genetic approaches to complement traditional genetic studies . Application of nascent technologies such as CRISPR interference for conditional gene regulation and single-cell tracking of BCE_2776 dynamics could reveal functional heterogeneity within bacterial populations. Collaborative research networks focusing on BCE_2776 and related UPF0421 family proteins across multiple bacterial species would accelerate progress through comparative approaches, potentially revealing conserved functions of this enigmatic protein family .

How can researchers design experiments to resolve current contradictions and knowledge gaps regarding BCE_2776?

Resolving contradictions and knowledge gaps regarding BCE_2776 requires carefully designed experiments that directly address areas of uncertainty while minimizing biases and artifacts . A systematic approach should begin with standardization of experimental conditions across laboratories, including strain backgrounds, growth conditions, and protein preparation protocols to determine whether apparent contradictions are due to methodological differences . Researchers should establish a consensus BCE_2776 knockout strategy using clean deletion methods that minimize polar effects on adjacent genes, complemented by conditional expression systems to study essential functions if conventional knockouts prove lethal . When contradictory localization patterns are reported, orthogonal techniques such as fractionation-based proteomics, immunogold electron microscopy, and live-cell fluorescence imaging should be applied in parallel to determine whether BCE_2776 exhibits dynamic localization depending on cellular conditions .

For contradictions in protein-protein interaction data, researchers should implement tiered validation approaches that progress from high-throughput screening to focused biochemical validation using purified components, with particular attention to membrane environment effects on interaction dynamics . The experimental design should include appropriate negative controls and comparison with established interaction partners to benchmark new findings. To address knowledge gaps in BCE_2776 function, researchers should develop clear hypothesis-driven research questions based on preliminary data and bioinformatic predictions, rather than unfocused exploratory studies . When designing such experiments, researchers should explicitly consider alternative hypotheses and include experimental conditions that could distinguish between competing models .

Temporal aspects of BCE_2776 function represent a significant knowledge gap that can be addressed through time-resolved studies examining expression, localization, and interaction partners throughout bacterial growth phases and during host infection . Technical innovations such as optogenetic control of BCE_2776 expression or activity could provide precise temporal resolution for functional studies. When analyzing experimental results, researchers should employ rigorous statistical approaches appropriate for the data type, with predefined criteria for significance and effect size estimation . Publication of negative results alongside positive findings would help define the boundaries of BCE_2776 function and prevent redundant exploration of unproductive research directions . By systematically addressing contradictions and knowledge gaps through these approaches, researchers can develop a coherent model of BCE_2776 function that integrates diverse experimental observations.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.