Recombinant Bacillus cereus UPF0421 protein BCE33L2478 (BCE33L2478)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: We will ship the format currently in stock unless otherwise specified. Please indicate your format preference in your order notes for special requests.
Lead Time
Delivery times vary depending on shipping method and location. Please contact your local distributor for specific delivery estimates.
Note: Our proteins are shipped on standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, which may serve as a reference for your needs.
Shelf Life
Shelf life depends on several factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The specific tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
BCE33L2478; UPF0421 protein BCE33L2478
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-355
Protein Length
full length protein
Species
Bacillus cereus (strain ZK / E33L)
Target Names
BCE33L2478
Target Protein Sequence
MNQVRKWNIIGGRVIKTGIAVFLTVLVCEFFNIPTIFAVITAIVTIEPTATDSIKKGLVR FPASTIGSAYAMTFTFFLGHQALSYALAAMFTIVTCQKLRLHAGTLVATLTAVAMIPITA DHYFTAFLIRLATTSTGIIVSTVVNFFILPPHYVKTISGCTEELFVKTANVMEEWLTALM DGKVIKKETTYNLSKLTVLLHKAVQFVQYEQKDWKYHRHTKKEMRSFLLVQKQLHLLQQI IYHIDNLARAPIETCDWSQNEKEILRRTIHSIISILRNHCEKIDEEHFKLIDELDKQFWT NKNDLAHCKPNQYHHHFSSESIILFEILSIHDMLEELKQIFEKYESENQLNCSVY
Uniprot No.

Target Background

Database Links
Protein Families
UPF0421 family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is the BCE33L2478 protein and what are its basic structural characteristics?

BCE33L2478 is an uncharacterized protein family (UPF0421) protein from Bacillus cereus with UniProt ID Q63AK0. The full-length protein consists of 355 amino acids and contains predicted transmembrane domains. Analysis of its amino acid sequence suggests it may function as a membrane protein involved in transport or signaling pathways. When expressed recombinantly, it is typically produced with an N-terminal histidine tag to facilitate purification .

What initial characterization methods should be employed for recombinant BCE33L2478?

Initial characterization should follow a systematic approach:

  • Confirm protein identity by SDS-PAGE and Western blotting with anti-His antibodies

  • Verify protein purity (>90% as typically supplied)

  • Perform mass spectrometry to confirm molecular weight

  • Analyze secondary structure using circular dichroism spectroscopy

  • Assess oligomeric state through size exclusion chromatography

  • Evaluate thermal stability using differential scanning fluorimetry

How should BCE33L2478 be properly reconstituted from lyophilized form?

Proper reconstitution is critical for maintaining protein functionality:

  • Centrifuge the vial briefly before opening to collect powder at the bottom

  • Reconstitute in deionized sterile water to 0.1-1.0 mg/mL concentration

  • For long-term storage, add glycerol to a final concentration of 5-50% (typically 50%)

  • Aliquot and store at -20°C/-80°C to avoid repeated freeze-thaw cycles

  • Reconstituted protein should be stored in Tris/PBS-based buffer with 6% trehalose at pH 8.0

What expression system is optimal for producing recombinant BCE33L2478?

The optimal expression system for BCE33L2478 is E. coli, as demonstrated in the commercially available recombinant product . For researchers designing their own expression protocols:

Expression ParameterRecommended ConditionRationale
Expression strainBL21(DE3), C41(DE3), or C43(DE3)Better for membrane/toxic proteins
Induction temperature16-20°CPromotes proper folding
IPTG concentration0.1-0.5 mMModerate induction prevents aggregation
MediaTerrific Broth or auto-inductionHigher biomass and protein yield
Expression time16-20 hoursExtended time at lower temperature

What purification strategy yields the highest purity BCE33L2478?

A multi-step purification approach is recommended:

  • Immobilized Metal Affinity Chromatography (IMAC) using Ni-NTA resin to capture the His-tagged protein

  • Size exclusion chromatography to remove aggregates and contaminants

  • If necessary, ion exchange chromatography as a polishing step

  • For membrane proteins, include appropriate detergents throughout purification

The final purity should exceed 90% as determined by SDS-PAGE, consistent with commercial preparations .

How can researchers address protein solubility challenges with BCE33L2478?

BCE33L2478, as a potential membrane protein, may present solubility challenges:

  • Screen multiple detergents (DDM, LDAO, LMNG) at various concentrations

  • Test buffer conditions with varying pH (6.5-8.5) and salt concentrations (100-500 mM NaCl)

  • Include stabilizing agents such as glycerol (5-20%) or specific lipids

  • Consider membrane-mimetic systems like nanodiscs or liposomes for functional studies

  • Maintain protein at concentrations below aggregation threshold (<5 mg/mL initially until stability is determined)

What bioinformatic tools are most useful for predicting the structural features of BCE33L2478?

Several complementary computational approaches should be employed:

Prediction ToolApplicationExpected Output
TMHMM/HMMTOPTransmembrane topologyPredicted TM segments
AlphaFold23D structure predictionComplete structural model
ConSurfEvolutionary conservationFunctionally important residues
SignalPSignal peptide predictionPotential secretion signals
InterProScanDomain identificationFunctional domains
PredictProteinSecondary structureα-helices, β-sheets distribution

How can researchers experimentally determine the membrane topology of BCE33L2478?

To experimentally verify membrane topology:

  • Cysteine-scanning mutagenesis combined with accessibility assays

  • Protease protection assays to identify cytoplasmic vs. periplasmic regions

  • GFP-fusion reporter assays at N and C termini

  • Site-directed fluorescence labeling at predicted loop regions

  • EPR spectroscopy with spin-labeled residues

  • Antibody epitope mapping against predicted extramembrane regions

What advanced structural biology techniques are appropriate for BCE33L2478?

For high-resolution structural analysis:

  • X-ray crystallography after detergent screening and crystallization optimization

  • Cryo-electron microscopy for protein in detergent micelles or nanodiscs

  • NMR spectroscopy for specific domains or dynamic regions

  • Hydrogen-deuterium exchange mass spectrometry for conformational dynamics

  • Small-angle X-ray scattering for low-resolution shape determination in solution

How can researchers identify potential functions of BCE33L2478?

Function identification requires multiple complementary approaches:

  • Sequence-based predictions using tools like InterPro, Pfam, and MOTIF

  • Structural homology to characterized proteins using Dali or VAST

  • Genomic context analysis - neighboring genes often have related functions

  • Gene co-expression analysis across different growth conditions

  • Phenotypic analysis of BCE33L2478 knockout strains in B. cereus

  • Heterologous expression in model organisms with defined phenotypic readouts

What methods can determine if BCE33L2478 is involved in B. cereus virulence?

To investigate potential roles in virulence:

  • Generate gene deletion mutants in virulent B. cereus strains

  • Compare enterotoxin production (HBL, NHE, CytK, EntFM) between wild-type and mutant strains

  • Assess adhesion and invasion of epithelial cells

  • Evaluate cytotoxicity using cell culture models

  • Analyze biofilm formation capacity

  • Test survival under conditions mimicking host environments (low pH, oxidative stress)

  • Perform transcriptomic analysis to identify co-regulated virulence factors

How can researchers determine potential interaction partners of BCE33L2478?

Protein interaction studies should include:

  • Affinity purification using His-tagged BCE33L2478 followed by mass spectrometry

  • Bacterial two-hybrid screening against B. cereus genomic library

  • Co-immunoprecipitation studies with antibodies against predicted interaction partners

  • Crosslinking mass spectrometry to capture transient interactions

  • Proximity labeling approaches (BioID, APEX) in native B. cereus

How might BCE33L2478 relate to B. cereus pathogenicity mechanisms?

While specific information about BCE33L2478's role in pathogenicity is limited, research approaches should consider:

  • Analyzing expression patterns during different growth phases and infection conditions

  • Investigating conservation across B. cereus strains with varying virulence profiles

  • Examining correlation with known virulence factors like enterotoxins (HBL, NHE) and emetic toxin

  • Determining if BCE33L2478 is regulated by known virulence regulators like PlcR

How can BCE33L2478 be studied in the context of B. cereus antibiotic resistance?

To investigate potential relationships with antibiotic resistance:

  • Compare expression levels in antibiotic-resistant versus susceptible strains

  • Test if knockout affects susceptibility to β-lactams and other antibiotics

  • Determine if BCE33L2478 can function as an efflux pump for antibiotics

  • Analyze if it contributes to membrane permeability or modification

B. cereus exhibits resistance to several antibiotics, particularly β-lactams, with resistance rates of 100% to penicillin, 99.73% to ampicillin, and 97.83% to amoxicillin-clavulanic acid .

What is known about BCE33L2478 distribution across different B. cereus strains?

Researchers should conduct comparative genomic analysis:

  • Analyze conservation across diverse B. cereus isolates from different sources

  • Determine if BCE33L2478 is part of the core genome or accessory genome

  • Identify sequence variations that might correlate with strain virulence

  • Use multilocus sequence typing (MLST) approaches similar to those used for general B. cereus characterization

  • Examine if the gene is located near any mobile genetic elements or pathogenicity islands

What are the critical considerations for site-directed mutagenesis experiments with BCE33L2478?

For effective mutagenesis studies:

  • Identify conserved residues through multiple sequence alignment of UPF0421 family proteins

  • Target predicted functional motifs based on computational analysis

  • Design an alanine-scanning strategy for initial functional mapping

  • Include both conserved and non-conserved residues as experimental controls

  • Verify mutant protein expression, folding, and stability before functional interpretation

  • Ensure proper experimental controls (wild-type protein, empty vector)

How should researchers design experiments to study BCE33L2478 localization in B. cereus?

To determine cellular localization:

  • Generate C-terminal or N-terminal fluorescent protein fusions (considering predicted topology)

  • Perform subcellular fractionation followed by Western blotting

  • Use immunogold electron microscopy with specific antibodies

  • Create GFP reporter fusions to study expression patterns under different conditions

  • Use fluorescence microscopy to track dynamic localization during growth and division

What control experiments are essential when studying BCE33L2478 function?

Critical controls include:

  • Wild-type protein expression alongside mutant constructs

  • Empty vector controls for expression studies

  • Complementation of knockout strains to confirm phenotype specificity

  • Heat-inactivated protein controls for enzymatic assays

  • Scrambled peptide controls for binding studies

  • Non-related membrane protein controls of similar size/topology

  • Multiple B. cereus strains to account for strain-specific effects

How can systems biology approaches enhance understanding of BCE33L2478 function?

Integrated systems approaches should include:

  • Transcriptomic analysis comparing wild-type and BCE33L2478 mutants under various conditions

  • Proteomic profiling to identify changes in protein expression and post-translational modifications

  • Metabolomic analysis to detect alterations in metabolic pathways

  • Network analysis to identify pathways influenced by BCE33L2478

  • Integration with existing B. cereus virulence network data

What novel methodologies might overcome challenges in studying membrane proteins like BCE33L2478?

Innovative approaches include:

  • Nanodiscs or styrene-maleic acid lipid particles (SMALPs) for detergent-free purification

  • Single-molecule fluorescence techniques to study conformational dynamics

  • In-cell NMR for structural studies in native-like environments

  • Microfluidic approaches for high-throughput functional screening

  • Genetic code expansion for site-specific incorporation of unnatural amino acids

  • Cryo-electron tomography for in situ structural analysis

How might comparisons with other UPF0421 family proteins inform BCE33L2478 research?

Comparative analysis should:

  • Identify functionally characterized UPF0421 family members in other bacteria

  • Conduct phylogenetic analysis to understand evolutionary relationships

  • Map conserved motifs that might indicate functional sites

  • Transfer functional insights from characterized homologs

  • Identify species-specific features that might relate to B. cereus pathogenicity

Table 1: Predicted Properties of BCE33L2478 Protein

PropertyValueMethod/Source
Length355 amino acidsUniProt (Q63AK0)
Molecular Weight~39.5 kDa (estimated)Calculated from sequence
Isoelectric Point~9.2 (estimated)Calculated from sequence
Transmembrane Domains8-10 (predicted)TMHMM analysis
Signal PeptideAbsent (predicted)SignalP analysis
Cofactor RequirementsUnknownRequires experimental verification
Cellular LocalizationMembrane (predicted)Based on sequence analysis
Evolutionary ConservationModerate across Bacillus speciesComparative sequence analysis

Table 2: Recommended Expression and Purification Conditions for BCE33L2478

ParameterRecommended ConditionNotes
Expression StrainE. coli BL21(DE3)Demonstrated compatibility
Expression Temperature18°CLower temperature for membrane proteins
Induction0.2 mM IPTGModerate induction to prevent aggregation
Lysis Buffer50 mM Tris-HCl pH 8.0, 300 mM NaCl, 10% glycerolCompatible with His-tag purification
Detergent for Extraction1% DDM or 1% LMNGMild detergents for membrane proteins
Purification MethodNi-NTA IMAC followed by SECMulti-step purification for high purity
Storage BufferTris/PBS-based, 6% trehalose, pH 8.0As used in commercial preparation
Storage Condition-80°C with 50% glycerolPrevents freeze-thaw damage
Reconstitution0.1-1.0 mg/mL in deionized waterPer manufacturer recommendation

Table 3: Potential Functional Assays for BCE33L2478 Characterization

Function CategoryAssay MethodExpected ReadoutTechnical Considerations
Membrane TransportLiposome reconstitution with fluorescent substratesSubstrate uptake or effluxRequires stable reconstitution in liposomes
Ion Channel ActivityPatch-clamp electrophysiologyIon conductanceRequires formation of stable membrane patches
Substrate BindingIsothermal titration calorimetryBinding affinity (Kd)Requires pure, stable protein
Enzymatic ActivityCoupled enzyme assaysSubstrate conversionDependent on hypothesized function
Protein-Protein InteractionPull-down followed by MSIdentified binding partnersMay require crosslinking for transient interactions
Virulence ContributionInfection assays with knockout strainsChanges in virulence markersRequires generation of genetic knockouts

Table 4: Comparison of BCE33L2478 with Known Virulence Factors in B. cereus

FeatureBCE33L2478Known B. cereus Virulence Factors
Gene LocationChromosome (predicted)Both chromosomal and plasmid-borne
Expression PatternUnknownGrowth phase dependent for many toxins
ConservationTo be determinedVariable; some universal (NHE, EntFM), some strain-specific
RegulationUnknownOften regulated by PlcR transcriptional activator
FunctionUnknown membrane proteinEnterotoxins, hemolysins, proteases
Presence Rate in StrainsTo be determinedVariable: NHE (83%), HBL (39%), CytK (68%), CesB (7%), EntFM (100%)

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.