Recombinant Bacillus cereus UPF0756 membrane protein BCA_4705 (BCA_4705)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them when placing your order, and we will fulfill your request.
Lead Time
Delivery time may vary depending on the purchase method and location. Please consult your local distributors for specific delivery timelines.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance as additional fees will apply.
Notes
Repeated freeze-thaw cycles are not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by various factors including storage conditions, buffer ingredients, storage temperature, and the intrinsic stability of the protein.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
BCA_4705; UPF0756 membrane protein BCA_4705
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-153
Protein Length
full length protein
Species
Bacillus cereus (strain 03BB102)
Target Names
BCA_4705
Target Protein Sequence
MISQSTLFLFILLIIGLIAKNQSLTVAIGVLFLLKFTFLGDKVFPYLQTKGINLGVTVIT IAVLVPIATGEIGFKQLGEAAKSYYAWIALASGVAVALLAKGGVQLLTTDPHITTALVFG TIIAVALFNGVAVGPLIGAGIAYAVMSIIQMFK
Uniprot No.

Target Background

Database Links

KEGG: bcx:BCA_4705

Protein Families
UPF0756 family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

How is recombinant BCA_4705 typically expressed and what are the common expression systems?

Recombinant BCA_4705 is predominantly expressed in E. coli expression systems, which offer a balance between yield and proper protein folding for this bacterial membrane protein. According to the product specifications, the most common approach involves:

  • Cloning the full-length gene (1-153 amino acids) into an expression vector

  • Adding an N-terminal His-tag for purification purposes

  • Transforming the construct into E. coli host cells

  • Inducing expression under controlled conditions

  • Harvesting and purifying using affinity chromatography

The recombinant protein is typically provided as a lyophilized powder with greater than 90% purity as determined by SDS-PAGE analysis . For researchers struggling with expression, variations in the signal peptide sequence or the use of specialized E. coli strains designed for membrane protein expression may improve yields.

What are the recommended protocols for reconstitution and storage of recombinant BCA_4705?

The proper handling of recombinant BCA_4705 is critical for maintaining its structural integrity and functionality. Based on manufacturer specifications, the following protocol is recommended:

Reconstitution Protocol:

  • Briefly centrifuge the vial prior to opening to bring contents to the bottom

  • Reconstitute in deionized sterile water to a concentration of 0.1-1.0 mg/mL

  • Add glycerol to a final concentration of 5-50% (optimally 50%) for long-term storage

  • Aliquot the reconstituted protein to minimize freeze-thaw cycles

Storage Conditions:

Storage PurposeTemperatureMaximum Duration
Long-term storage-20°C to -80°CSeveral months
Working aliquots4°CUp to one week
Shipping/transportOn iceMinimize time

It is crucial to avoid repeated freeze-thaw cycles as they significantly degrade membrane protein structure and functionality . For experimental reproducibility, document the number of freeze-thaw cycles each aliquot undergoes.

What are the potential functional roles of BCA_4705 in Bacillus cereus based on current research?

While the specific function of BCA_4705 remains to be fully elucidated, comparative analysis with other UPF0756 family members and examination of Bacillus cereus membrane proteins provides valuable insights:

  • Membrane Barrier Function: As part of the membrane proteome, BCA_4705 likely contributes to cell membrane integrity and selective permeability

  • Potential Transport Role: The protein sequence contains features consistent with transporters, possibly for simple carbohydrates like glucose or fructose, which are preferentially utilized by Bacillus cereus

  • Potential Role in Spore Formation/Germination: Bacillus cereus spores contain a specialized inner membrane with proteins involved in dormancy and germination. Some membrane proteins show differential expression between vegetative cells and spores

  • Possible Involvement in Pathogenicity: Membrane proteins in B. cereus can contribute to virulence and toxin secretion. While not directly characterized as a virulence factor, BCA_4705 may play an indirect role in pathogenicity mechanisms

Research comparing the membrane proteome of B. cereus spores and vegetative cells has identified numerous membrane-specific proteins with specialized functions, suggesting BCA_4705 may have stage-specific roles in the bacterial life cycle .

What are the recommended approaches for studying protein-protein interactions involving BCA_4705?

Investigating the interaction partners of BCA_4705 requires specialized techniques suitable for membrane proteins:

  • Membrane Yeast Two-Hybrid System: A modified version of the traditional yeast two-hybrid specifically designed for membrane proteins that maintains the membrane environment necessary for proper folding

  • Cross-linking Mass Spectrometry: Chemical cross-linking followed by proteomic analysis can identify proteins in close proximity to BCA_4705 within the membrane

  • Co-immunoprecipitation with Membrane Solubilization: Using mild detergents to solubilize the membrane while preserving protein-protein interactions, followed by immunoprecipitation with anti-BCA_4705 or anti-tag antibodies

  • Biolayer Interferometry or Surface Plasmon Resonance: For quantitative measurement of binding kinetics between purified BCA_4705 and potential interaction partners

  • Bacterial Two-Hybrid Systems: Specialized for membrane proteins in bacterial expression systems

The challenge with membrane protein interaction studies lies in maintaining the native lipid environment. Nanodiscs or liposome reconstitution may provide more physiologically relevant conditions than detergent solubilization alone .

What biophysical methods are most appropriate for structural characterization of BCA_4705?

The structural analysis of membrane proteins presents unique challenges that require specialized approaches:

MethodApplication to BCA_4705Technical Considerations
X-ray CrystallographyHigh-resolution structural determinationRequires successful crystallization, which is challenging for membrane proteins
Cryo-electron MicroscopyVisualization of protein in near-native stateMay require larger size or complexes for optimal resolution
NMR SpectroscopyDynamics and structural information in solutionIsotope labeling required; size limitations may apply
Small-angle X-ray ScatteringLow-resolution envelope of protein shapeWorks in solution but provides limited detailed information
Hydrogen-Deuterium Exchange MSIdentifies exposed regions and structural dynamicsCan work with limited amounts of protein

For BCA_4705 specifically, initial characterization using CD spectroscopy to confirm secondary structure content, followed by more advanced techniques based on protein yield and purity, would be a logical progression. The 153-amino acid size makes it amenable to solution NMR if sufficient quantities can be produced with isotope labeling .

How does BCA_4705 compare with homologous proteins across different Bacillus species and other bacterial genera?

Comparative analysis of BCA_4705 with homologs reveals evolutionary relationships and potential functional conservation:

  • Within Bacillus cereus Strains: High sequence conservation exists between UPF0756 membrane proteins from different B. cereus strains, such as BCA_4705 and BCAH820_4710, suggesting essential functionality. For example, the two proteins share identical amino acid sequences despite coming from different B. cereus strains .

  • Across Bacillus Species: Moderate to high sequence homology exists with other Bacillus species, with varying degrees of functional conservation. This conservation pattern suggests fundamental roles in Bacillus physiology.

  • Beyond Bacillus Genus: Lower but significant homology may exist with membrane proteins in other Gram-positive bacteria, potentially indicating convergent evolution for similar membrane functions.

Sequence alignment tools reveal conserved domains likely essential for function, while variable regions may reflect species-specific adaptations. The UPF0756 family designation indicates that while the protein is recognized as a conserved family, its precise function remains to be fully characterized experimentally .

What approaches can be used to determine the physiological role of BCA_4705 in Bacillus cereus?

Elucidating the function of BCA_4705 requires a multi-faceted approach:

  • Gene Knockout/Knockdown Studies: Creating BCA_4705 deletion mutants in B. cereus to observe phenotypic changes related to growth, stress resistance, or virulence

  • Overexpression Analysis: Examining the effects of BCA_4705 overexpression on cellular physiology and membrane characteristics

  • Localization Studies: Using fluorescent protein fusions or immunofluorescence to determine subcellular localization patterns during different growth phases

  • Transcriptomic Analysis: RNA-seq to identify co-regulated genes, providing insights into biological pathways involving BCA_4705

  • Comparative Proteomics: Comparing membrane proteome composition between wild-type and BCA_4705 mutant strains under various conditions

  • Metabolomic Profiling: Identifying metabolic changes associated with BCA_4705 mutation, particularly focusing on membrane-associated metabolism

  • Lipidomic Analysis: Examining if BCA_4705 affects membrane lipid composition or organization

Research on other Bacillus membrane proteins suggests potential roles in nutrient transport, signaling, spore formation, or virulence . Given the importance of membrane proteins in B. cereus pathogenicity, investigating BCA_4705's role in toxin secretion or host interaction would be valuable .

How can researchers effectively reconstitute BCA_4705 into membrane mimetic systems for functional studies?

Membrane reconstitution is essential for studying the native behavior of BCA_4705:

Protocol for Liposome Reconstitution:

  • Prepare lipid mixture mimicking B. cereus membrane composition (phosphatidylethanolamine, phosphatidylglycerol, and cardiolipin at appropriate ratios)

  • Dissolve lipids in chloroform, dry to form a thin film, then hydrate with aqueous buffer

  • Subject to freeze-thaw cycles followed by extrusion through defined pore-size filters

  • Solubilize liposomes with mild detergent

  • Add purified BCA_4705 at protein:lipid ratio of 1:100 to 1:1000

  • Remove detergent using Bio-Beads or dialysis

  • Verify incorporation using density gradient centrifugation or light scattering

Alternative Membrane Mimetic Systems:

  • Nanodiscs: Provide a defined lipid environment with better stability than liposomes

  • Bicelles: Intermediate between micelles and bilayers, useful for NMR studies

  • GUVs (Giant Unilamellar Vesicles): Suitable for microscopy-based functional assays

The choice of lipid composition significantly impacts the folding and function of membrane proteins like BCA_4705. Starting with lipid compositions that mimic B. cereus membranes provides the most physiologically relevant environment .

What are the common challenges in expression and purification of BCA_4705, and how can they be addressed?

Membrane proteins present unique challenges in recombinant expression and purification:

ChallengeSymptomsSolutions
Low expression levelsMinimal protein band on SDS-PAGEUse specialized E. coli strains (C41, C43); optimize codon usage; lower induction temperature (16-20°C)
Protein misfolding/aggregationInclusion body formationExpress with fusion partners (MBP, SUMO); include chemical chaperones in media; use mild solubilization conditions
Detergent selection issuesLoss of protein during solubilizationScreen detergent panel (DDM, LDAO, FC-12); use detergent mixtures; consider amphipols for stability
Purification lossesDecreasing yield during purification stepsMinimize purification steps; maintain detergent above CMC throughout; add glycerol to all buffers
Tag interferenceAltered protein behaviorConsider tag location (N vs C-terminal); include longer linkers; use cleavable tags

Success with BCA_4705 may be improved by using specialized expression systems designed for membrane proteins, such as those described for expressing other challenging membrane proteins from B. cereus . Expression in C43(DE3) E. coli cells has been successfully used for other membrane proteins from B. cereus and might be applicable to BCA_4705 .

How can researchers troubleshoot experiments when studying potential interactions between BCA_4705 and other bacterial proteins?

When investigating protein-protein interactions involving BCA_4705, several common issues may arise:

  • False Negatives in Interaction Studies:

    • Ensure membrane environment is preserved during experiments

    • Try multiple detergents or lipid compositions

    • Use crosslinking approaches to capture transient interactions

    • Verify protein functionality before interaction studies

  • High Background or False Positives:

    • Increase stringency of washing steps

    • Include appropriate controls (non-specific membrane proteins)

    • Validate interactions with multiple independent methods

    • Consider the impact of tags on interaction surfaces

  • Interpretation Challenges:

    • Distinguish direct interactions from membership in the same complex

    • Consider the spatial organization of membrane proteins

    • Examine interaction under different physiological conditions

    • Validate in vivo relevance of interactions observed in vitro

When designing interaction experiments, consider that BCA_4705's function may be linked to other membrane processes in B. cereus. Cross-reference with studies on membrane protein complexes involved in transport, signaling, or virulence to identify potential interaction partners for targeted investigation .

What is the potential significance of BCA_4705 in Bacillus cereus pathogenicity research?

While BCA_4705 has not been directly characterized as a virulence factor, understanding its role could provide insights into B. cereus pathogenicity:

  • Membrane Integrity and Stress Response: Membrane proteins play critical roles in bacterial survival under host-imposed stress conditions. BCA_4705 may contribute to membrane adaptation during infection .

  • Toxin Secretion Systems: B. cereus pathogenicity depends on efficient secretion of toxins across the membrane. Membrane proteins can form part of secretion machinery or influence membrane properties affecting secretion efficiency .

  • Host-Pathogen Interactions: Surface-exposed portions of membrane proteins can mediate adhesion to host cells or evasion of host immune responses.

  • Antimicrobial Resistance: Membrane proteins can contribute to intrinsic resistance to antimicrobials by altering membrane permeability or participating in efflux systems .

Research on other B. cereus membrane proteins has demonstrated their importance in virulence. For example, B. cereus produces membrane-associated collagenases that cause tissue damage and facilitate bacterial spread in wound infections . Similarly, membrane-bound beta-lactamases contribute to antibiotic resistance .

How does the study of BCA_4705 contribute to our understanding of membrane biology in spore-forming bacteria?

Bacillus cereus transitions between vegetative cells and dormant spores, with membrane proteins playing specialized roles in each state:

  • Comparative Membrane Proteomics: Studies of B. cereus have identified significant differences between vegetative cell membranes and spore inner membranes. Analysis of BCA_4705 expression and localization during sporulation and germination would reveal its stage-specific functions .

  • Spore Resistance Properties: The spore inner membrane has unusual properties contributing to extreme resistance. BCA_4705 may participate in establishing or maintaining these specialized membrane characteristics .

  • Germination Signaling: Membrane proteins in the spore inner membrane detect germinants and transmit signals initiating germination. BCA_4705 could potentially function in these sensing or signaling pathways .

  • Membrane Remodeling: During the transition between vegetative and spore states, extensive membrane remodeling occurs. Membrane proteins like BCA_4705 may facilitate these structural transformations.

Research has shown that the spore inner membrane contains a distinct set of proteins compared to vegetative cells, with transporters for simple carbohydrates being particularly important for the early stages of germination . Determining whether BCA_4705 is preferentially associated with vegetative cells or spores would provide important clues about its function.

Frequently Asked Questions for Researchers: Recombinant Bacillus cereus UPF0756 membrane protein BCA_4705 (BCA_4705)

This comprehensive collection of research-focused questions and answers has been compiled to assist investigators working with the Recombinant Bacillus cereus UPF0756 membrane protein BCA_4705. The information addresses both fundamental concepts and advanced research methodologies relevant to this bacterial membrane protein.

How is recombinant BCA_4705 typically expressed and what are the common expression systems?

Recombinant BCA_4705 is predominantly expressed in E. coli expression systems, which offer a balance between yield and proper protein folding for this bacterial membrane protein. According to the product specifications, the most common approach involves:

  • Cloning the full-length gene (1-153 amino acids) into an expression vector

  • Adding an N-terminal His-tag for purification purposes

  • Transforming the construct into E. coli host cells

  • Inducing expression under controlled conditions

  • Harvesting and purifying using affinity chromatography

The recombinant protein is typically provided as a lyophilized powder with greater than 90% purity as determined by SDS-PAGE analysis . For researchers struggling with expression, variations in the signal peptide sequence or the use of specialized E. coli strains designed for membrane protein expression may improve yields.

What are the recommended protocols for reconstitution and storage of recombinant BCA_4705?

The proper handling of recombinant BCA_4705 is critical for maintaining its structural integrity and functionality. Based on manufacturer specifications, the following protocol is recommended:

Reconstitution Protocol:

  • Briefly centrifuge the vial prior to opening to bring contents to the bottom

  • Reconstitute in deionized sterile water to a concentration of 0.1-1.0 mg/mL

  • Add glycerol to a final concentration of 5-50% (optimally 50%) for long-term storage

  • Aliquot the reconstituted protein to minimize freeze-thaw cycles

Storage Conditions:

Storage PurposeTemperatureMaximum Duration
Long-term storage-20°C to -80°CSeveral months
Working aliquots4°CUp to one week
Shipping/transportOn iceMinimize time

It is crucial to avoid repeated freeze-thaw cycles as they significantly degrade membrane protein structure and functionality . For experimental reproducibility, document the number of freeze-thaw cycles each aliquot undergoes.

What are the potential functional roles of BCA_4705 in Bacillus cereus based on current research?

While the specific function of BCA_4705 remains to be fully elucidated, comparative analysis with other UPF0756 family members and examination of Bacillus cereus membrane proteins provides valuable insights:

  • Membrane Barrier Function: As part of the membrane proteome, BCA_4705 likely contributes to cell membrane integrity and selective permeability

  • Potential Transport Role: The protein sequence contains features consistent with transporters, possibly for simple carbohydrates like glucose or fructose, which are preferentially utilized by Bacillus cereus

  • Potential Role in Spore Formation/Germination: Bacillus cereus spores contain a specialized inner membrane with proteins involved in dormancy and germination. Some membrane proteins show differential expression between vegetative cells and spores

  • Possible Involvement in Pathogenicity: Membrane proteins in B. cereus can contribute to virulence and toxin secretion. While not directly characterized as a virulence factor, BCA_4705 may play an indirect role in pathogenicity mechanisms

Research comparing the membrane proteome of B. cereus spores and vegetative cells has identified numerous membrane-specific proteins with specialized functions, suggesting BCA_4705 may have stage-specific roles in the bacterial life cycle .

What are the recommended approaches for studying protein-protein interactions involving BCA_4705?

Investigating the interaction partners of BCA_4705 requires specialized techniques suitable for membrane proteins:

  • Membrane Yeast Two-Hybrid System: A modified version of the traditional yeast two-hybrid specifically designed for membrane proteins that maintains the membrane environment necessary for proper folding

  • Cross-linking Mass Spectrometry: Chemical cross-linking followed by proteomic analysis can identify proteins in close proximity to BCA_4705 within the membrane

  • Co-immunoprecipitation with Membrane Solubilization: Using mild detergents to solubilize the membrane while preserving protein-protein interactions, followed by immunoprecipitation with anti-BCA_4705 or anti-tag antibodies

  • Biolayer Interferometry or Surface Plasmon Resonance: For quantitative measurement of binding kinetics between purified BCA_4705 and potential interaction partners

  • Bacterial Two-Hybrid Systems: Specialized for membrane proteins in bacterial expression systems

The challenge with membrane protein interaction studies lies in maintaining the native lipid environment. Nanodiscs or liposome reconstitution may provide more physiologically relevant conditions than detergent solubilization alone .

What biophysical methods are most appropriate for structural characterization of BCA_4705?

The structural analysis of membrane proteins presents unique challenges that require specialized approaches:

MethodApplication to BCA_4705Technical Considerations
X-ray CrystallographyHigh-resolution structural determinationRequires successful crystallization, which is challenging for membrane proteins
Cryo-electron MicroscopyVisualization of protein in near-native stateMay require larger size or complexes for optimal resolution
NMR SpectroscopyDynamics and structural information in solutionIsotope labeling required; size limitations may apply
Small-angle X-ray ScatteringLow-resolution envelope of protein shapeWorks in solution but provides limited detailed information
Hydrogen-Deuterium Exchange MSIdentifies exposed regions and structural dynamicsCan work with limited amounts of protein

For BCA_4705 specifically, initial characterization using CD spectroscopy to confirm secondary structure content, followed by more advanced techniques based on protein yield and purity, would be a logical progression. The 153-amino acid size makes it amenable to solution NMR if sufficient quantities can be produced with isotope labeling .

How does BCA_4705 compare with homologous proteins across different Bacillus species and other bacterial genera?

Comparative analysis of BCA_4705 with homologs reveals evolutionary relationships and potential functional conservation:

  • Within Bacillus cereus Strains: High sequence conservation exists between UPF0756 membrane proteins from different B. cereus strains, such as BCA_4705 and BCAH820_4710, suggesting essential functionality. For example, the two proteins share identical amino acid sequences despite coming from different B. cereus strains .

  • Across Bacillus Species: Moderate to high sequence homology exists with other Bacillus species, with varying degrees of functional conservation. This conservation pattern suggests fundamental roles in Bacillus physiology.

  • Beyond Bacillus Genus: Lower but significant homology may exist with membrane proteins in other Gram-positive bacteria, potentially indicating convergent evolution for similar membrane functions.

Sequence alignment tools reveal conserved domains likely essential for function, while variable regions may reflect species-specific adaptations. The UPF0756 family designation indicates that while the protein is recognized as a conserved family, its precise function remains to be fully characterized experimentally .

What approaches can be used to determine the physiological role of BCA_4705 in Bacillus cereus?

Elucidating the function of BCA_4705 requires a multi-faceted approach:

  • Gene Knockout/Knockdown Studies: Creating BCA_4705 deletion mutants in B. cereus to observe phenotypic changes related to growth, stress resistance, or virulence

  • Overexpression Analysis: Examining the effects of BCA_4705 overexpression on cellular physiology and membrane characteristics

  • Localization Studies: Using fluorescent protein fusions or immunofluorescence to determine subcellular localization patterns during different growth phases

  • Transcriptomic Analysis: RNA-seq to identify co-regulated genes, providing insights into biological pathways involving BCA_4705

  • Comparative Proteomics: Comparing membrane proteome composition between wild-type and BCA_4705 mutant strains under various conditions

  • Metabolomic Profiling: Identifying metabolic changes associated with BCA_4705 mutation, particularly focusing on membrane-associated metabolism

  • Lipidomic Analysis: Examining if BCA_4705 affects membrane lipid composition or organization

Research on other Bacillus membrane proteins suggests potential roles in nutrient transport, signaling, spore formation, or virulence . Given the importance of membrane proteins in B. cereus pathogenicity, investigating BCA_4705's role in toxin secretion or host interaction would be valuable .

How can researchers effectively reconstitute BCA_4705 into membrane mimetic systems for functional studies?

Membrane reconstitution is essential for studying the native behavior of BCA_4705:

Protocol for Liposome Reconstitution:

  • Prepare lipid mixture mimicking B. cereus membrane composition (phosphatidylethanolamine, phosphatidylglycerol, and cardiolipin at appropriate ratios)

  • Dissolve lipids in chloroform, dry to form a thin film, then hydrate with aqueous buffer

  • Subject to freeze-thaw cycles followed by extrusion through defined pore-size filters

  • Solubilize liposomes with mild detergent

  • Add purified BCA_4705 at protein:lipid ratio of 1:100 to 1:1000

  • Remove detergent using Bio-Beads or dialysis

  • Verify incorporation using density gradient centrifugation or light scattering

Alternative Membrane Mimetic Systems:

  • Nanodiscs: Provide a defined lipid environment with better stability than liposomes

  • Bicelles: Intermediate between micelles and bilayers, useful for NMR studies

  • GUVs (Giant Unilamellar Vesicles): Suitable for microscopy-based functional assays

The choice of lipid composition significantly impacts the folding and function of membrane proteins like BCA_4705. Starting with lipid compositions that mimic B. cereus membranes provides the most physiologically relevant environment .

What are the common challenges in expression and purification of BCA_4705, and how can they be addressed?

Membrane proteins present unique challenges in recombinant expression and purification:

ChallengeSymptomsSolutions
Low expression levelsMinimal protein band on SDS-PAGEUse specialized E. coli strains (C41, C43); optimize codon usage; lower induction temperature (16-20°C)
Protein misfolding/aggregationInclusion body formationExpress with fusion partners (MBP, SUMO); include chemical chaperones in media; use mild solubilization conditions
Detergent selection issuesLoss of protein during solubilizationScreen detergent panel (DDM, LDAO, FC-12); use detergent mixtures; consider amphipols for stability
Purification lossesDecreasing yield during purification stepsMinimize purification steps; maintain detergent above CMC throughout; add glycerol to all buffers
Tag interferenceAltered protein behaviorConsider tag location (N vs C-terminal); include longer linkers; use cleavable tags

Success with BCA_4705 may be improved by using specialized expression systems designed for membrane proteins, such as those described for expressing other challenging membrane proteins from B. cereus . Expression in C43(DE3) E. coli cells has been successfully used for other membrane proteins from B. cereus and might be applicable to BCA_4705 .

How can researchers troubleshoot experiments when studying potential interactions between BCA_4705 and other bacterial proteins?

When investigating protein-protein interactions involving BCA_4705, several common issues may arise:

  • False Negatives in Interaction Studies:

    • Ensure membrane environment is preserved during experiments

    • Try multiple detergents or lipid compositions

    • Use crosslinking approaches to capture transient interactions

    • Verify protein functionality before interaction studies

  • High Background or False Positives:

    • Increase stringency of washing steps

    • Include appropriate controls (non-specific membrane proteins)

    • Validate interactions with multiple independent methods

    • Consider the impact of tags on interaction surfaces

  • Interpretation Challenges:

    • Distinguish direct interactions from membership in the same complex

    • Consider the spatial organization of membrane proteins

    • Examine interaction under different physiological conditions

    • Validate in vivo relevance of interactions observed in vitro

When designing interaction experiments, consider that BCA_4705's function may be linked to other membrane processes in B. cereus. Cross-reference with studies on membrane protein complexes involved in transport, signaling, or virulence to identify potential interaction partners for targeted investigation .

What is the potential significance of BCA_4705 in Bacillus cereus pathogenicity research?

While BCA_4705 has not been directly characterized as a virulence factor, understanding its role could provide insights into B. cereus pathogenicity:

  • Membrane Integrity and Stress Response: Membrane proteins play critical roles in bacterial survival under host-imposed stress conditions. BCA_4705 may contribute to membrane adaptation during infection .

  • Toxin Secretion Systems: B. cereus pathogenicity depends on efficient secretion of toxins across the membrane. Membrane proteins can form part of secretion machinery or influence membrane properties affecting secretion efficiency .

  • Host-Pathogen Interactions: Surface-exposed portions of membrane proteins can mediate adhesion to host cells or evasion of host immune responses.

  • Antimicrobial Resistance: Membrane proteins can contribute to intrinsic resistance to antimicrobials by altering membrane permeability or participating in efflux systems .

Research on other B. cereus membrane proteins has demonstrated their importance in virulence. For example, B. cereus produces membrane-associated collagenases that cause tissue damage and facilitate bacterial spread in wound infections . Similarly, membrane-bound beta-lactamases contribute to antibiotic resistance .

How does the study of BCA_4705 contribute to our understanding of membrane biology in spore-forming bacteria?

Bacillus cereus transitions between vegetative cells and dormant spores, with membrane proteins playing specialized roles in each state:

  • Comparative Membrane Proteomics: Studies of B. cereus have identified significant differences between vegetative cell membranes and spore inner membranes. Analysis of BCA_4705 expression and localization during sporulation and germination would reveal its stage-specific functions .

  • Spore Resistance Properties: The spore inner membrane has unusual properties contributing to extreme resistance. BCA_4705 may participate in establishing or maintaining these specialized membrane characteristics .

  • Germination Signaling: Membrane proteins in the spore inner membrane detect germinants and transmit signals initiating germination. BCA_4705 could potentially function in these sensing or signaling pathways .

  • Membrane Remodeling: During the transition between vegetative and spore states, extensive membrane remodeling occurs. Membrane proteins like BCA_4705 may facilitate these structural transformations.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.