Recombinant Bacillus cereus UPF0756 membrane protein BCAH187_A4721 (BCAH187_A4721)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, should you have specific requirements for the format, please indicate them when placing the order. We will prepare the product accordingly.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributors for specific delivery timeframes.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please communicate with us in advance. Additional charges may apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly prior to opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by various factors including storage conditions, buffer ingredients, temperature, and the protein's inherent stability.
Generally, the shelf life of the liquid form is 6 months at -20°C/-80°C. The shelf life of the lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
Tag type is determined during the production process. If you have a specific tag type preference, please communicate it to us. We will prioritize developing the specified tag.
Synonyms
BCAH187_A4721; UPF0756 membrane protein BCAH187_A4721
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-153
Protein Length
full length protein
Species
Bacillus cereus (strain AH187)
Target Names
BCAH187_A4721
Target Protein Sequence
MISQSTLFLFILLIIGLIAKNQSLTVAIGVLFLLKFTFLGDKVFPYLQTKGINLGVTVIT IAVLVPIATGEIGFKQLGEAAKSYYAWIALASGVAVALLAKGGVQLLTTDPHITTALVFG TIIAVALFNGVAVGPLIGAGIAYAVMSIIQMFK
Uniprot No.

Target Background

Database Links
Protein Families
UPF0756 family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

Why use Bacillus cereus as a model organism for studying membrane proteins?

Bacillus cereus serves as an excellent model organism for studying membrane proteins due to its close evolutionary relationship with other Bacillus species, particularly B. anthracis, while requiring only biosafety level 1 (BSL-1) facilities. B. cereus is categorized as an opportunistic pathogen that typically causes food poisoning treatable without medical intervention, unlike B. anthracis which requires strict BSL-3 practices and negative room pressure environments . Despite these safety differences, B. cereus shares many critical genes with B. anthracis, making it an ideal surrogate for studying orthologous proteins without significant safety concerns .

What expression systems are most effective for recombinant production of B. cereus membrane proteins?

For recombinant production of B. cereus membrane proteins like BCAH187_A4721, E. coli expression systems with modified pET vectors (such as pET49bm) have demonstrated high efficacy. The recommended approach involves:

  • Genomic DNA preparation from B. cereus

  • PCR amplification of the target gene with appropriate restriction enzyme sites

  • Digestion of the PCR product and vector with corresponding restriction enzymes

  • Ligation of the digested PCR product and vector

  • Transformation into E. coli DH5α cells for plasmid propagation

  • Final transformation into an expression strain of E. coli for protein production

This method has been shown to yield approximately 8 mg of purified recombinant protein per liter of culture for similar B. cereus proteins .

What purification strategy should I use for initial characterization of BCAH187_A4721?

A multi-step purification strategy is recommended for initial characterization:

Purification StepMethodPurposeExpected Outcome
Initial CaptureNickel-affinity chromatographyIsolation of His-tagged protein~90% purity
Tag RemovalThrombin digestionRemoval of affinity tagNative protein sequence
PolishingSize exclusion chromatography (SEC)Removal of aggregates and contaminants~99% purity

For optimal results, conduct a thrombin digestion trial to determine the minimum amount required for complete tag removal. Typically, 6 units of thrombin per mg of recombinant protein is sufficient for complete digestion .

How can I determine the oligomerization state of BCAH187_A4721?

The oligomerization state of membrane proteins like BCAH187_A4721 can be determined through a factorial approach combining multiple complementary techniques:

  • Size exclusion chromatography (SEC) to estimate molecular weight in solution

  • Dynamic light scattering (DLS) to measure the hydrodynamic radius

  • Native PAGE to analyze oligomeric state under non-denaturing conditions

  • Chemical crosslinking followed by SDS-PAGE to capture transient interactions

  • X-ray crystallography or cryo-EM for structural determination

When analyzing SEC data, construct a calibration curve using molecular weight standards and calculate the oligomerization state by comparing the elution volume of your protein against the calibration curve. For membrane proteins, be aware that detergent micelles can affect apparent molecular weight calculations .

What approaches can overcome solubility challenges when working with BCAH187_A4721?

Membrane proteins present unique solubility challenges due to their hydrophobic surfaces. Several approaches can be employed:

  • Traditional detergent-based methods:

    • Screen multiple detergents (DDM, LDAO, OG) at various concentrations

    • Test detergent mixtures for enhanced stability

    • Incorporate cholesterol or lipids for stabilization

  • Novel protein WRAPS approach:

    • Employ Water-soluble RFdiffused Amphipathic Proteins (WRAPS) designed through deep learning

    • These de novo proteins surround hydrophobic surfaces of membrane proteins

    • Render the protein water-soluble without detergents while preserving structure and function

The WRAPS approach has demonstrated success with both β-barrel outer membrane and helical multi-pass transmembrane proteins, potentially offering advantages for studying proteins like BCAH187_A4721 with enhanced stability .

What crystallization strategies are most effective for membrane proteins like BCAH187_A4721?

Crystallization of membrane proteins remains challenging but several strategies have proven effective:

  • Initial screening approach:

    • Use commercial sparse matrix screens specifically designed for membrane proteins

    • Test multiple detergent conditions in parallel

    • Explore lipidic cubic phase (LCP) crystallization methods

    • Consider bicelles or nanodiscs as alternative membrane mimetics

  • Optimization considerations:

    • Fine-tune protein:precipitant ratios (typically 1:1, 2:1, and 1:2)

    • Test temperature variations (4°C, 18°C, 25°C)

    • Incorporate additives like small amphiphiles or specific lipids

    • Employ seeding techniques for crystal growth enhancement

For successful crystallization, ensure protein purity exceeds 95% and monitor monodispersity using DLS before setting up crystal trays. Crystal optimization often requires multiple iterations, focusing on conditions that produce initial crystal hits .

How can cryo-EM be applied to study the structure of BCAH187_A4721?

Cryo-EM represents a powerful alternative to X-ray crystallography for membrane protein structural determination:

  • Sample preparation considerations:

    • Test multiple grid types (e.g., Quantifoil R1.2/1.3, UltrAuFoil)

    • Optimize protein concentration (typically 2-5 mg/mL)

    • Evaluate various blotting times and conditions

    • Consider WRAPS-solubilized protein preparation to avoid detergent interference

  • Data collection and processing:

    • Collect motion-corrected image series

    • Perform CTF estimation and correction

    • Select particles and conduct 2D classification

    • Generate 3D reconstructions through refinement

The WRAPS approach has demonstrated success in generating a 4.0 Å cryo-EM map for a membrane protein (TP0698), suggesting this could be applicable to BCAH187_A4721 .

How do I design assays to determine the function of BCAH187_A4721?

Designing functional assays for uncharacterized membrane proteins like BCAH187_A4721 requires a systematic approach:

  • Bioinformatic analysis:

    • Conduct sequence homology searches against characterized proteins

    • Identify conserved domains and motifs

    • Perform structural prediction and threading against known structures

    • Analyze genomic context for functional clues

  • Activity screening approach:

    • Screen for nucleotide pyrophosphohydrolase activity if sequence suggests MazG-like function

    • Test binding to potential ligands using thermal shift assays

    • Examine protein-protein interactions through pull-down assays

    • Assess membrane transport capabilities if transmembrane domains are present

  • Validation methods:

    • Generate site-directed mutants of predicted catalytic residues

    • Perform complementation studies in knockout strains

    • Compare kinetic parameters with related proteins

What approaches can determine if BCAH187_A4721 forms functional complexes with other proteins?

To investigate potential protein-protein interactions and complex formation:

  • Co-immunoprecipitation studies:

    • Express tagged BCAH187_A4721 in B. cereus

    • Solubilize membranes with mild detergents

    • Capture protein complexes using antibodies against the tag

    • Identify binding partners through mass spectrometry

  • Cross-linking mass spectrometry:

    • Treat purified protein or membrane fractions with chemical crosslinkers

    • Digest crosslinked samples with proteases

    • Analyze crosslinked peptides by LC-MS/MS

    • Identify interaction interfaces through bioinformatic analysis

  • Bacterial two-hybrid screening:

    • Construct fusion proteins with BCAH187_A4721

    • Screen against a B. cereus genomic library

    • Validate positive interactions through reciprocal testing

    • Confirm in vivo using fluorescence resonance energy transfer (FRET)

How does BCAH187_A4721 compare to its orthologs in other Bacillus species?

Comparative analysis of BCAH187_A4721 with orthologs in related Bacillus species provides valuable evolutionary and functional insights:

SpeciesOrthologSequence IdentityStructural DifferencesFunctional Differences
B. anthracisBA1554~90-95%Likely minimalUnder investigation
B. thuringiensisBT1364~85-90%Potentially in surface loopsUnder investigation
B. subtilis(If exists)LowerMay have domain reorganizationPotentially different

This high sequence conservation across Bacillus species, particularly between B. cereus and B. anthracis, suggests critical functional roles for these proteins . When conducting comparative studies:

  • Perform multiple sequence alignments to identify conserved residues

  • Generate homology models to visualize structural conservation

  • Compare biochemical properties if functional data is available

  • Consider phylogenetic analysis to understand evolutionary relationships

What experimental approaches can help resolve contradictory data about BCAH187_A4721 function?

When faced with contradictory data regarding protein function:

  • Experimental validation:

    • Reproduce experiments using standardized protocols

    • Validate reagents and constructs through sequencing

    • Use multiple independent methods to assess the same function

    • Test function under varied conditions (pH, temperature, ion concentrations)

  • Statistical analysis:

    • Implement factorial experimental designs to identify variables affecting outcomes

    • Use ANOVA to determine significance of conflicting results

    • Consider interaction effects between experimental factors

    • Calculate effect sizes to understand the magnitude of contradictions

  • Resolution strategies:

    • Generate domain-specific or site-directed mutants to isolate functions

    • Determine structure-function relationships through truncation analysis

    • Consider potential post-translational modifications affecting function

    • Evaluate oligomerization states under different experimental conditions

What quality control measures are essential before proceeding with advanced studies of BCAH187_A4721?

Implement these quality control measures before advanced characterization:

Quality Control StepMethodAcceptance Criteria
Purity AssessmentSDS-PAGE>95% purity (single band)
Identity ConfirmationMass spectrometryMatches theoretical mass ±0.1%
Monodispersity CheckDLS/SECSingle peak, PDI <0.2
Proper FoldingCircular dichroismCharacteristic secondary structure pattern
Activity VerificationFunctional assayActivity within 80-120% of reference

Additionally, perform batch-to-batch consistency checks to ensure reproducibility before initiating crystallization trials or other advanced structural studies .

How can I optimize detergent selection for BCAH187_A4721 purification and characterization?

Detergent selection is critical for membrane protein research. Implement this systematic approach:

  • Initial screening:

    • Test a panel of detergents from different classes:

      • Maltosides (DDM, DM)

      • Glucosides (OG, NG)

      • Phosphocholines (FC-12, FC-14)

      • Nonionic (Triton X-100, C12E8)

    • Evaluate extraction efficiency via Western blot

    • Assess protein stability via thermal shift assays

  • Optimization:

    • Fine-tune detergent concentration relative to CMC

    • Test detergent mixtures for improved stability

    • Incorporate cholesterol or specific lipids as stabilizers

    • Consider novel alternatives like WRAPS if traditional detergents prove challenging

  • Functional verification:

    • Confirm that purified protein retains activity in selected detergent

    • Test long-term stability at various temperatures

    • Monitor oligomeric state in different detergent environments

How can structural studies of BCAH187_A4721 contribute to antimicrobial development?

Structural characterization of BCAH187_A4721 could support antimicrobial development through:

  • Structure-based drug design:

    • Identify unique structural features in the bacterial protein

    • Define potential binding pockets through computational analysis

    • Conduct virtual screening against these targets

    • Validate hits through biochemical and biophysical assays

  • Comparative structural biology:

    • Analyze structural differences between bacterial and host orthologs

    • Identify selective targeting opportunities

    • Design inhibitors exploiting bacterial-specific features

    • Test specificity using biochemical assays

  • Epitope mapping:

    • Determine surface-exposed regions unique to bacterial proteins

    • Evaluate accessibility in the native membrane environment

    • Assess conservation across pathogenic Bacillus strains

    • Consider as potential vaccine components if sufficiently immunogenic

What are the most effective approaches for studying post-translational modifications of BCAH187_A4721?

To investigate potential post-translational modifications (PTMs):

  • Mass spectrometry-based approaches:

    • Employ bottom-up proteomics with multiple proteases

    • Use electron transfer dissociation for PTM site localization

    • Implement targeted MS/MS for specific modification detection

    • Quantify modification stoichiometry using stable isotope labeling

  • Site-specific analysis:

    • Generate site-directed mutants of potential modification sites

    • Compare wild-type and mutant properties (stability, activity)

    • Use specific antibodies against common modifications

    • Employ chemical probes for detecting specific PTMs

  • Functional correlation:

    • Compare protein isolated from different growth conditions

    • Assess effects of stress responses on modification patterns

    • Determine if modifications affect protein-protein interactions

    • Evaluate impact on subcellular localization and membrane integration

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.