Recombinant Bacillus cereus UPF0756 membrane protein BCAH820_4710 (BCAH820_4710)

Shipped with Ice Packs
In Stock

Description

Introduction to Recombinant Bacillus cereus UPF0756 Membrane Protein BCAH820_4710

The Recombinant Bacillus cereus UPF0756 membrane protein BCAH820_4710 (BCAH820_4710) is a recombinant protein derived from Bacillus cereus, a Gram-positive, rod-shaped bacterium known for its role in food poisoning and its ability to form highly resistant spores. This protein is part of the UPF0756 family, which is associated with membrane functions in bacteria. The recombinant version of this protein is expressed in Escherichia coli (E. coli) and is tagged with a His-tag for purification purposes.

Characteristics of Recombinant BCAH820_4710 Protein

  • Species: Bacillus cereus

  • Source: Expressed in E. coli

  • Tag: N-terminal His-tag

  • Protein Length: Full-length (1-153 amino acids)

  • Form: Lyophilized powder

  • Purity: Greater than 90% as determined by SDS-PAGE

  • Storage Buffer: Tris/PBS-based buffer, 6% Trehalose, pH 8.0

CharacteristicsDescription
SpeciesBacillus cereus
SourceE. coli
TagN-terminal His-tag
Protein LengthFull-length (1-153aa)
FormLyophilized powder
Purity>90% (SDS-PAGE)
Storage BufferTris/PBS-based, 6% Trehalose, pH 8.0

Expression and Purification

The recombinant BCAH820_4710 protein is expressed in E. coli, which is a common host for recombinant protein production due to its well-understood genetics and efficient expression systems. The His-tag facilitates purification using affinity chromatography, such as Ni-NTA columns.

References Creative Biomart. Recombinant Full Length Bacillus Cereus Upf0756 Membrane Protein Bcg9842_B0533 (Bcg9842_B0533) Protein, His-Tagged. Frontiers in Microbiology. Adaptation in Bacillus cereus: From Stress to Disease. Creative Biomart. Recombinant Full Length Bacillus Cereus Upf0756 Membrane Protein Bcah820_4710 (Bcah820_4710) Protein, His-Tagged. PMC. The Membrane Proteome of Spores and Vegetative Cells of the Food-Borne Pathogen Bacillus cereus. NCBI Bookshelf. Bacillus Cereus. PubMed. Expression and Purification of Transmembrane Protein MerE from Mercury-Resistant Bacteria. PubMed. The Membrane Proteome of Spores and Vegetative Cells of Bacillus cereus. Wikipedia. Bacillus cereus. Afigen. ELISA Recombinant Bacillus cereus UPF0756 membrane protein BC_4596(BC_4596).

Product Specs

Form
Lyophilized powder
Please note: We will prioritize shipping the format currently in stock. However, if you have a specific format requirement, please indicate it in your order notes, and we will prepare the product according to your request.
Lead Time
Delivery time may vary depending on the purchasing method or location. Please consult your local distributors for specific delivery time estimates.
Note: All our proteins are shipped with standard blue ice packs by default. If you require dry ice shipment, please contact us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial prior to opening to ensure the contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
The shelf life of the product is influenced by various factors such as storage conditions, buffer composition, temperature, and the intrinsic stability of the protein itself.
Generally, the shelf life of the liquid form is 6 months at -20°C/-80°C. The shelf life of the lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during production. If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
BCAH820_4710; UPF0756 membrane protein BCAH820_4710
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-153
Protein Length
full length protein
Species
Bacillus cereus (strain AH820)
Target Names
BCAH820_4710
Target Protein Sequence
MISQSTLFLFILLIIGLIAKNQSLTVAIGVLFLLKFTFLGDKVFPYLQTKGINLGVTVIT IAVLVPIATGEIGFKQLGEAAKSYYAWIALASGVAVALLAKGGVQLLTTDPHITTALVFG TIIAVALFNGVAVGPLIGAGIAYAVMSIIQMFK
Uniprot No.

Target Background

Database Links
Protein Families
UPF0756 family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is Recombinant Bacillus cereus UPF0756 membrane protein BCAH820_4710?

Recombinant Bacillus cereus UPF0756 membrane protein BCAH820_4710 is a full-length (153 amino acid) membrane protein derived from the Bacillus cereus bacterium. The protein is typically produced with an N-terminal His tag through heterologous expression in E. coli expression systems. The protein is identified in UniProt under accession number B7JRW8 and typically supplied as a lyophilized powder with greater than 90% purity as determined by SDS-PAGE . This membrane protein belongs to the UPF0756 protein family, which comprises proteins of unknown function that exhibit membrane localization characteristics .

How does BCAH820_4710 compare to other UPF0756 family members in Bacillus species?

The BCAH820_4710 protein shows high sequence homology with other UPF0756 membrane proteins in Bacillus cereus strains, such as BCG9842_B0533 (UniProt ID: B7IJZ3). Both proteins share identical amino acid sequences (153 aa) despite being from different B. cereus isolates, suggesting strong conservation of this protein within the species . This high degree of sequence conservation implies functional importance, despite being categorized as an uncharacterized protein family (UPF). Comparative genomic analyses suggest this protein is conserved across the Bacillus genus, with homologs found in B. anthracis, B. thuringiensis, and other related species, though with varying degrees of sequence identity.

What are the optimal conditions for reconstituting lyophilized BCAH820_4710 to maintain protein integrity?

For optimal reconstitution of lyophilized BCAH820_4710 protein, follow this methodology:

  • Centrifuge the vial briefly (30 seconds at 10,000 × g) to collect all material at the bottom before opening

  • Reconstitute in deionized sterile water to achieve a concentration of 0.1-1.0 mg/mL

  • Add glycerol to a final concentration of 5-50% (recommended optimal: 50%) for long-term stability

  • Prepare working aliquots to avoid repeated freeze-thaw cycles

  • Store reconstituted protein at 4°C for short-term use (up to one week)

  • For long-term storage, maintain aliquots at -20°C or -80°C

The reconstitution buffer (Tris/PBS-based buffer with 6% Trehalose, pH 8.0) is designed to maintain the native conformation of membrane proteins. The addition of glycerol serves as a cryoprotectant to prevent protein denaturation during freeze-thaw cycles. Researchers should validate protein activity after reconstitution using functional assays appropriate to their experimental design.

How can I design a single-subject experimental protocol to evaluate BCAH820_4710 function in membrane transport studies?

When designing a single-subject experimental protocol for evaluating BCAH820_4710 function in membrane transport, consider this methodological framework:

  • Baseline Phase (A):

    • Measure transport rates or membrane permeability in liposomes lacking BCAH820_4710

    • Collect at least 5 data points under consistent conditions to establish a stable baseline

    • Ensure minimal variability in measurements to facilitate clear visual analysis of results

  • Intervention Phase (B):

    • Introduce BCAH820_4710 into identical liposome preparations

    • Maintain all other experimental variables constant

    • Collect at least 5 data points post-intervention

  • Return to Baseline (A'):

    • Remove or inhibit the protein (using specific antibodies or competitive inhibitors)

    • Collect measurements to determine if transport returns to baseline levels

  • Reintroduction (B'):

    • Reintroduce the protein and measure transport again to establish replication

This A-B-A'-B' design provides internal replication and controls for potential confounding variables. Measurements should be taken by multiple researchers (at least 20% of data points), and interassessor agreement should be established . This approach meets the standards for single-subject experimental design in evidence-based practice and allows for robust determination of BCAH820_4710's functional effects on membrane transport.

What experimental approaches can resolve contradictory data regarding BCAH820_4710 membrane topology?

When faced with contradictory data regarding BCAH820_4710 membrane topology, a multi-methodological approach is recommended:

When results diverge, systematically eliminate technical variables by standardizing membrane composition, protein:lipid ratios, and buffer conditions across all experiments. Document experimental conditions thoroughly to identify potential sources of variability. The integration of multiple independent approaches increases confidence in the final topological model by overcoming the inherent limitations of any single method.

What role does BCAH820_4710 likely play in Bacillus cereus membrane physiology based on proteomics data?

Based on comprehensive membrane proteomics studies of Bacillus cereus, UPF0756 membrane proteins like BCAH820_4710 are likely to play roles in several critical physiological processes:

  • Membrane Structure and Integrity:
    The hydrophobic nature and predicted transmembrane domains suggest a structural role in maintaining membrane architecture, particularly during transitions between vegetative and sporulation states.

  • Metabolite Transport:
    Proteomics comparison between vegetative cells and spores indicates differential expression of membrane transporters. While vegetative cells express diverse transporters, spore membranes retain specific transporters for simple carbohydrates like glucose and fructose. BCAH820_4710 may contribute to this selective transport system during dormancy or germination .

  • Signaling Pathways:
    The inner spore membrane serves as a scaffold for proteins involved in signal transduction. The location of BCAH820_4710 in this membrane suggests potential involvement in germination signaling cascades or environmental sensing mechanisms .

  • Stress Response:
    The conserved nature of this protein across Bacillus species suggests a fundamental role in membrane adaptation to environmental stressors, particularly those affecting spore dormancy and resistance.

Quantitative proteomics data indicates differential expression between vegetative cells and spores, with specific roles potentially emerging during transitions between these states. The protein may contribute to the remarkable resistance properties of Bacillus spores, particularly in maintaining selective permeability of the inner spore membrane during dormancy .

How can I determine if BCAH820_4710 forms oligomeric structures in the membrane?

To determine the oligomeric state of BCAH820_4710 in membranes, employ a multi-tiered analytical approach:

  • In vitro Crosslinking Studies:

    • Treat purified protein in detergent micelles or reconstituted into liposomes with membrane-permeable crosslinkers (e.g., DSS, glutaraldehyde)

    • Analyze by SDS-PAGE to visualize potential oligomeric forms

    • Validate with Western blotting using anti-His antibodies to confirm specificity

    • Use concentration gradients to distinguish between specific and non-specific interactions

  • Biophysical Characterization:

    • Analytical ultracentrifugation to determine sedimentation coefficients of protein-detergent complexes

    • Size exclusion chromatography coupled with multi-angle light scattering (SEC-MALS) to determine absolute molecular mass

    • Blue native PAGE to preserve native interactions while separating by size

  • Direct Visualization Techniques:

    • Single-particle cryo-electron microscopy of purified protein in nanodiscs

    • Atomic force microscopy of 2D crystals in supported lipid bilayers

    • FRET analysis using strategically labeled protein variants

  • Functional Validation:

    • Co-expression of wild-type and mutant variants with complementary tags

    • Co-immunoprecipitation to confirm physical association

    • Functional assays comparing monomeric versus oligomeric fractions

For quantitative assessment, analyze crosslinking efficiency across protein concentrations and membrane compositions using densitometry. Plot the relationship between protein concentration and oligomer formation to determine the equilibrium constant for oligomerization and assess the cooperativity of the process.

What computational tools are most appropriate for predicting BCAH820_4710 structure given its membrane localization?

For accurate computational prediction of BCAH820_4710 structure, specialized tools optimized for membrane proteins should be employed:

Computational ApproachSpecific ToolsAdvantagesLimitations
Transmembrane Topology PredictionTMHMM, HMMTOP, PhobiusIdentifies membrane-spanning regionsLimited to topology, not 3D structure
Homology ModelingSWISS-MODEL with membrane filter, MODELLER with membrane constraintsLeverages structures of related proteinsDepends on available templates
Ab Initio ModelingROSETTA-Membrane, AlphaFold-MembraneCan work without close homologsComputationally intensive
Molecular DynamicsGROMACS, NAMD with specialized membrane force fieldsSimulates protein in lipid environmentRequires initial structural model
Coevolutionary AnalysisEVfold, RaptorX-ContactIdentifies residue contacts from sequence alignmentsRequires large sequence families

For BCAH820_4710, a recommended workflow would be:

  • Initial topology prediction using consensus from multiple predictors (TMHMM, HMMTOP)

  • Template identification through structural databases (PDB, AlphaFoldDB) focusing on UPF0756 family or similar membrane proteins

  • Hybrid modeling approach combining:

    • AlphaFold2 prediction with membrane-specific parameters

    • Refinement in explicit membrane environment using molecular dynamics

    • Validation using predicted contacts from coevolutionary analysis

The integration of experimental data (even limited data like accessibility studies) can significantly improve model accuracy through distance or orientation constraints. For validation, use QMEANBrane or ProQM scoring specifically developed for membrane protein model quality assessment.

What are the most effective methods for assessing the quality and activity of purified BCAH820_4710?

To comprehensively assess the quality and activity of purified BCAH820_4710, implement this systematic quality control protocol:

  • Purity Assessment:

    • SDS-PAGE analysis (target: >90% purity)

    • Western blotting with anti-His antibodies to confirm identity

    • Mass spectrometry verification of molecular weight and sequence coverage

  • Structural Integrity:

    • Circular dichroism (CD) spectroscopy to analyze secondary structure content

    • Fluorescence spectroscopy to evaluate tertiary structure via intrinsic tryptophan emission

    • Dynamic light scattering to assess homogeneity and detect aggregation

  • Functional Activity:

    • Reconstitution into liposomes with subsequent permeability assays

    • Binding studies with potential interaction partners

    • Comparative activity across different lipid compositions

  • Stability Analysis:

    • Thermal shift assays to determine melting temperature

    • Time-course activity measurements under storage conditions

    • Freeze-thaw stability testing

A critical quality control metric is the protein's behavior in reconstitution experiments. Membrane proteins should incorporate efficiently into liposomes without significant aggregation. This can be monitored by sucrose density gradient centrifugation or light scattering techniques. Additionally, since specific functional assays may be challenging for uncharacterized proteins like BCAH820_4710, comparative analysis with homologous proteins of known function can provide benchmarks for quality assessment .

How can I troubleshoot poor expression yields of BCAH820_4710 in E. coli systems?

When encountering poor expression yields of BCAH820_4710, implement this systematic troubleshooting approach:

  • Expression Strain Optimization:

    StrainAdvantagesBest For
    BL21(DE3)Standard expressionInitial screening
    C41(DE3)/C43(DE3)Membrane protein specialistsToxic membrane proteins
    Lemo21(DE3)Tunable expressionExpression level optimization
    RosettaRare codon supplementationProteins with rare codons
  • Expression Vector Modifications:

    • Optimize codon usage for E. coli without altering amino acid sequence

    • Test different fusion partners (MBP, SUMO, Thioredoxin) for solubility enhancement

    • Evaluate alternative signal sequences for improved membrane targeting

    • Implement stronger/weaker/inducible promoters to balance expression levels

  • Growth Condition Optimization:

    • Reduce induction temperature (16-25°C) to slow folding and prevent aggregation

    • Test various inducers and concentrations (IPTG 0.1-1.0 mM)

    • Supplement with membrane components (phospholipids, cholesterol)

    • Implement auto-induction media for gradual protein expression

  • Extraction and Purification Refinement:

    • Screen detergent panel for optimal extraction (DDM, LDAO, Fos-choline)

    • Include specific lipids during purification to maintain stability

    • Add glycerol or specific stabilizing compounds to buffers

    • Optimize imidazole concentration gradient during IMAC purification

For systematic optimization, implement a design of experiments (DoE) approach using fractional factorial design to efficiently test multiple variables simultaneously. Monitor expression using both total protein analysis (SDS-PAGE) and functional incorporation (membrane fractionation) to distinguish between expression and proper folding/targeting issues.

What strategies can resolve contradictory experimental findings when characterizing BCAH820_4710?

When facing contradictory experimental results in BCAH820_4710 characterization, implement this methodological framework for resolution:

  • Data Triangulation Protocol:

    • Validate findings using at least three independent methodological approaches

    • Ensure each approach has distinct underlying principles and potential biases

    • Analyze convergence/divergence patterns to identify methodological limitations

  • Sequential Experimental Design:

    PhaseFocusOutcome
    ExploratoryBroad hypothesis testingIdentify potential sources of contradiction
    TargetedSpecific variable isolationDetermine critical experimental parameters
    ValidationRigorous replicationEstablish reproducibility under controlled conditions
  • Systematic Variable Elimination:

    • Protein preparation (batch variation, storage conditions, aggregation state)

    • Membrane environment (lipid composition, protein:lipid ratio, reconstitution method)

    • Assay conditions (buffer composition, temperature, pH, ionic strength)

    • Data analysis approaches (statistical methods, baseline corrections, normalization)

  • Collaborative Cross-Validation:

    • Implement blinded analysis by multiple researchers

    • Exchange materials between laboratories to test reagent/equipment effects

    • Standardize protocols with detailed procedural documentation

When analyzing contradictory findings, particularly examine the baseline variation in experimental systems as shown in Panel B and Panel C of Figure 2 in reference . Establish whether contradictions arise from inherent system variability versus true experimental effects by implementing appropriate controls that can distinguish between these scenarios. Document all experimental conditions comprehensively, including seemingly minor variables that could impact membrane protein behavior.

How can BCAH820_4710 be utilized to study membrane dynamics during Bacillus cereus sporulation and germination?

BCAH820_4710 offers unique opportunities as a molecular tool for investigating membrane dynamics during Bacillus cereus sporulation and germination:

  • Protein Tagging Strategies:

    • Generate fluorescently tagged BCAH820_4710 constructs (GFP, mCherry) for real-time visualization

    • Create epitope-tagged versions for immunolocalization studies

    • Develop photoactivatable variants for pulse-chase experiments tracking protein movement

  • Temporal Expression Analysis:

    • Quantify BCAH820_4710 expression levels throughout sporulation and germination

    • Correlate protein abundance with specific stages of development

    • Compare expression patterns with other membrane proteins to identify functional clusters

  • Reconstitution Experiments:

    • Create artificial membrane systems incorporating purified BCAH820_4710

    • Measure changes in membrane properties (fluidity, permeability, rigidity)

    • Test effects of sporulation-specific lipids on protein function

  • Mutant Analysis:

    • Generate conditional knockdown/knockout strains

    • Assess impact on spore formation, dormancy, and germination efficiency

    • Perform complementation studies with site-directed mutants to identify critical residues

This approach can address fundamental questions about membrane remodeling during sporulation, particularly the dramatic transformation from vegetative cell membrane to the compressed inner spore membrane. Proteomics data indicates significant differences between vegetative cell membrane proteins (498 identified) and spore inner membrane proteins (244 identified), with 54 spore-specific membrane proteins . Understanding BCAH820_4710's potential role in this specialized membrane environment could provide insights into the exceptional resistance properties of bacterial spores.

What experimental design would best evaluate the potential role of BCAH820_4710 in antimicrobial resistance?

To investigate BCAH820_4710's potential role in antimicrobial resistance, implement this comprehensive experimental design:

  • Expression Correlation Analysis:

    • Measure BCAH820_4710 expression levels in:

      • Wild-type B. cereus exposed to sublethal antimicrobial concentrations

      • Clinical isolates with varying resistance profiles

      • Laboratory-evolved resistant strains

    • Correlate expression with minimum inhibitory concentrations (MICs)

  • Genetic Manipulation Studies:

    ApproachTechniqueExpected Outcome
    Loss-of-FunctionCRISPR-Cas9 knockoutDetermine if deletion impacts susceptibility
    Gain-of-FunctionControlled overexpressionAssess if increased expression confers resistance
    Mutation AnalysisSite-directed mutagenesisIdentify critical functional residues
  • Mechanistic Investigations:

    • Measure membrane permeability to antimicrobials in the presence/absence of BCAH820_4710

    • Assess direct binding between antimicrobials and purified protein

    • Analyze changes in membrane potential and proton gradients

    • Determine effects on efflux pump activity and efficiency

  • In vitro Reconstitution:

    • Create liposomes with/without BCAH820_4710

    • Compare antimicrobial permeability across these artificial membranes

    • Test synergy with known resistance determinants

  • Structural Analysis:

    • Identify potential antimicrobial binding sites through in silico docking

    • Confirm interactions through binding assays (ITC, SPR, MST)

    • Visualize structural changes upon antimicrobial binding

This experimental design incorporates multiple levels of evidence from genetic correlation to direct biochemical interaction. Special attention should be paid to the baseline variability of resistance phenotypes, implementing appropriate controls as described in experimental design literature . The design allows for distinguishing between direct effects (e.g., BCAH820_4710 as an antimicrobial target or efflux component) and indirect effects (e.g., general membrane integrity alterations).

What methodological approaches would determine if BCAH820_4710 interacts with other membrane proteins in Bacillus cereus?

To identify and characterize protein-protein interactions between BCAH820_4710 and other Bacillus cereus membrane proteins, implement this methodological framework:

  • In vivo Interaction Screening:

    • Bacterial two-hybrid system optimized for membrane proteins

    • Split-GFP complementation assays in B. cereus

    • In vivo crosslinking followed by co-immunoprecipitation

    • FRET/BRET analysis of fluorescently tagged protein pairs

  • Co-purification Approaches:

    • Tandem affinity purification (TAP) with BCAH820_4710 as bait

    • Size exclusion chromatography to identify stable complexes

    • Blue native PAGE to preserve native interactions

    • Chemical crosslinking coupled with mass spectrometry (XL-MS)

  • Direct Binding Analysis:

    TechniqueApplicationAdvantage
    Surface Plasmon Resonance (SPR)Kinetic measurementsReal-time monitoring
    Microscale Thermophoresis (MST)Binding affinitiesLow sample consumption
    Isothermal Titration Calorimetry (ITC)Thermodynamic parametersLabel-free method
    Bio-Layer Interferometry (BLI)Association/dissociation ratesHigh-throughput screening
  • Structural Visualization:

    • Cryo-electron microscopy of purified complexes

    • Single-particle analysis to determine stoichiometry

    • Hydrogen-deuterium exchange mass spectrometry to map interaction surfaces

    • Disulfide crosslinking to confirm proximity of specific residues

  • Functional Validation:

    • Competitive inhibition assays using synthetic peptides

    • Mutational analysis of predicted interaction surfaces

    • Co-expression studies with activity measurements

    • Liposome reconstitution with purified components

When analyzing interaction data, implement appropriate statistical models to distinguish specific from non-specific interactions. Particular attention should be paid to the membrane environment during these studies, as interactions may depend on specific lipid compositions or membrane potentials. This comprehensive approach provides multiple lines of evidence to confirm authentic protein-protein interactions while minimizing false positives common in membrane protein interaction studies.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.