Recombinant Bacillus cereus UPF0756 membrane protein BCB4264_A4705 (BCB4264_A4705)

Shipped with Ice Packs
In Stock

Description

Introduction to Recombinant Bacillus cereus UPF0756 Membrane Protein BCB4264_A4705

The Recombinant Bacillus cereus UPF0756 membrane protein BCB4264_A4705 is a recombinant protein derived from the bacterium Bacillus cereus. This protein is part of the UPF0756 family, which is associated with membrane functions in bacteria. The protein is expressed in Escherichia coli (E. coli) and is tagged with a His-tag for purification purposes. This article will delve into the characteristics, expression, and potential applications of this protein.

Expression and Purification

The Recombinant Bacillus cereus UPF0756 membrane protein BCB4264_A4705 is expressed in E. coli, which is a common host for recombinant protein production due to its ease of manipulation and high yield. The protein is purified using affinity chromatography, facilitated by the N-terminal His-tag. This method allows for efficient separation of the recombinant protein from other cellular components.

Biological Role

Membrane proteins like BCB4264_A4705 play critical roles in cellular processes, including transport, signaling, and structural support. In Bacillus cereus, these proteins are essential for maintaining cellular integrity and facilitating interactions with the environment.

Research Implications

Studies on membrane proteins of Bacillus cereus have shown that they are crucial for the bacterium's survival and pathogenicity. For instance, membrane proteins involved in spore germination and vegetative growth are vital for the lifecycle of Bacillus cereus . While specific research on BCB4264_A4705 is limited, its classification as a UPF0756 membrane protein suggests potential involvement in similar processes.

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have specific format requirements, please specify them in your order notes. We will fulfill your request if possible.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please contact your local distributor for specific delivery times.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%, which can be used as a reference.
Shelf Life
The shelf life is influenced by several factors including storage conditions, buffer components, temperature, and protein stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot the protein for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is determined during production. If you have specific tag type preferences, please inform us, and we will prioritize developing the specified tag.
Synonyms
BCB4264_A4705; UPF0756 membrane protein BCB4264_A4705
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-153
Protein Length
full length protein
Species
Bacillus cereus (strain B4264)
Target Names
BCB4264_A4705
Target Protein Sequence
MISQSTLFLFILLIIGLIAKNQSLTVAIGVLFLLKFTFLGDKVFPYLQTKGINLGVTVIT IAVLVPIATGEIGFKQLGEAAKSYYAWIALASGVAVALLAKGGVQLLTTDPHITTALVFG TVIAVALFNGVAVGPLIGAGIAYAVMSIIQMFK
Uniprot No.

Target Background

Database Links
Protein Families
UPF0756 family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

How does BCB4264_A4705 relate to other proteins within the Bacillus cereus group?

The BCB4264_A4705 protein belongs to the UPF0756 family of membrane proteins found in Bacillus cereus. The Bacillus cereus group (B. cereus sensu lato) comprises six closely related species: B. cereus, B. anthracis, B. thuringiensis, B. mycoides, B. pseudomycoides, and B. weihenstephanensis . These species share significant genetic similarity, with DNA-DNA hybridization and rRNA sequence analyses failing to clearly separate these taxa .

The conservation of this membrane protein across the B. cereus group suggests potential functional importance, though protein expression profiles may vary between species. Comparative genomic analyses indicate horizontal gene transfer events have shaped the evolution of proteins in this bacterial group, potentially including membrane proteins like BCB4264_A4705 .

What expression systems are most effective for producing recombinant BCB4264_A4705?

Based on current research protocols, E. coli expression systems have proven effective for the production of recombinant BCB4264_A4705 protein. The methodology typically involves:

  • Gene cloning into an appropriate vector containing an N-terminal His-tag for purification purposes

  • Transformation into a competent E. coli expression strain

  • Induction of protein expression under optimized conditions

  • Cell lysis and protein extraction

  • Purification using affinity chromatography targeting the His-tag

The recombinant protein is typically produced as a fusion protein with an N-terminal His-tag, which facilitates purification without significantly affecting the protein's structural integrity . The expression system yields protein with greater than 90% purity as determined by SDS-PAGE analysis .

What are the optimal storage and reconstitution conditions for BCB4264_A4705 recombinant protein?

The optimal storage and handling conditions for BCB4264_A4705 recombinant protein are critical for maintaining its stability and functionality. The following table summarizes the recommended protocols:

ParameterRecommended ConditionsNotes
Storage Temperature-20°C to -80°CLong-term storage
Working Temperature4°CFor up to one week
Buffer CompositionTris/PBS-based buffer, pH 8.0 with 6% Trehalose or Tris-based buffer with 50% glycerol Optimized for protein stability
ReconstitutionDeionized sterile water (0.1-1.0 mg/mL)Brief centrifugation prior to opening is recommended
Post-reconstitution Addition5-50% glycerol (final concentration)For long-term storage stability
Freeze-thaw CyclesAvoid repeated cyclesAliquot before freezing

Following centrifugation of the vial to bring contents to the bottom, reconstitution should be performed using deionized sterile water to achieve a concentration of 0.1-1.0 mg/mL. For extended storage after reconstitution, addition of glycerol (5-50% final concentration) is recommended before aliquoting and freezing to minimize damage from freeze-thaw cycles .

What analytical methods are most appropriate for confirming the purity and activity of BCB4264_A4705?

Multiple analytical techniques should be employed to verify both the purity and functional activity of recombinant BCB4264_A4705:

Purity Assessment:

  • SDS-PAGE with Coomassie or silver staining (target purity >90%)

  • Western blotting using anti-His antibodies to confirm tag presence

  • Size exclusion chromatography to evaluate aggregation state

  • Mass spectrometry for precise molecular weight determination and sequence verification

Functional Assessment:

  • Circular dichroism spectroscopy to evaluate secondary structure

  • Liposome incorporation assays to confirm membrane insertion capabilities

  • Protein-specific activity assays (when function is determined)

Since BCB4264_A4705 is a membrane protein with currently undefined specific functions, structural integrity assessment through biophysical techniques provides the primary means of quality control. Comparison with predicted membrane topology models can provide additional confidence in proper protein folding .

How can researchers optimize solubilization of BCB4264_A4705 for functional studies?

Membrane proteins like BCB4264_A4705 present challenges for solubilization while maintaining native structure. A methodological approach includes:

  • Initial Screening: Test multiple detergents at varying concentrations:

    • Mild detergents: n-Dodecyl β-D-maltoside (DDM), n-Decyl-β-D-Maltopyranoside (DM)

    • Zwitterionic detergents: CHAPS, CHAPSO

    • Newer agents: Amphipols, nanodiscs, SMALPs (Styrene Maleic Acid Lipid Particles)

  • Optimization Protocol:

    • Solubilize lyophilized protein initially in a buffer containing 1-2% detergent

    • Incubate at 4°C with gentle agitation for 1-2 hours

    • Centrifuge at high speed (100,000 × g) to remove insoluble material

    • Assess protein in supernatant via absorbance at 280 nm or Bradford assay

    • Evaluate structural integrity using circular dichroism or fluorescence spectroscopy

  • Detergent Exchange: If necessary, gradually replace initial solubilization detergent with a detergent more suitable for downstream applications through dialysis or gel filtration

This systematic approach allows identification of conditions that maintain the protein in a soluble, correctly folded state while preserving potential functional activity .

What methodologies are recommended for investigating potential interaction partners of BCB4264_A4705?

Several complementary approaches can be employed to identify potential protein-protein interactions involving BCB4264_A4705:

  • Affinity-based Methods:

    • Pull-down assays using His-tagged BCB4264_A4705 as bait

    • Co-immunoprecipitation with antibodies against BCB4264_A4705

    • Chemical cross-linking followed by mass spectrometry (CXMS)

  • Library Screening Approaches:

    • Bacterial two-hybrid systems (more suitable than yeast two-hybrid for membrane proteins)

    • Phage display screening using BCB4264_A4705 as the target

  • In silico Prediction:

    • Computational prediction of protein-protein interactions based on:

      • Structural homology to proteins with known interaction partners

      • Sequence motifs associated with specific interactions

      • Co-expression patterns with other B. cereus proteins

  • Direct Biophysical Measurements:

    • Surface plasmon resonance (SPR) with immobilized BCB4264_A4705

    • Isothermal titration calorimetry (ITC) for quantitative binding parameters

    • Microscale thermophoresis (MST) for interaction analysis in solution

Since BCB4264_A4705 is a membrane protein, all experimental designs must account for the hydrophobic nature of the protein by incorporating appropriate detergents or membrane-mimetic systems to maintain protein structure and accessibility of interaction surfaces .

How might BCB4264_A4705 contribute to the pathogenicity mechanisms of Bacillus cereus?

While direct evidence linking BCB4264_A4705 to pathogenicity is not explicit in the available literature, several hypotheses can be proposed based on its nature as a membrane protein in a known pathogen:

  • Potential Roles in Pathogenicity:

    • Membrane-associated virulence factor

    • Component of secretion systems for toxin delivery

    • Involvement in adhesion to host tissues

    • Contribution to antimicrobial resistance through membrane permeability control

B. cereus pathogenicity primarily relies on the secretion of toxins and enzymes, including hemolysins and enterotoxins . As a membrane protein, BCB4264_A4705 could potentially participate in secretory pathways or membrane remodeling during infection processes. Additionally, B. cereus can undergo swarming differentiation in response to surface sensing, which enhances its virulence potential .

A comprehensive investigation would require:

  • Construction of gene knockout mutants

  • Comparative virulence assays between wild-type and mutant strains

  • Localization studies during infection

  • Transcriptomic analysis under infection-relevant conditions

  • Protein-protein interaction studies focusing on known virulence factors

Such studies would help elucidate whether BCB4264_A4705 contributes directly to pathogenicity or plays a supporting role in bacterial physiology during infection .

What experimental design would best determine the membrane topology of BCB4264_A4705?

Determining the membrane topology of BCB4264_A4705 requires a multi-technique approach:

  • Computational Prediction:

    • Begin with transmembrane domain prediction using algorithms such as TMHMM, Phobius, or MEMSAT

    • Create a topological model identifying potential membrane-spanning regions, cytoplasmic, and extracellular domains

  • Biochemical Validation:

    • Cysteine scanning mutagenesis:

      • Introduce cysteine residues at strategic positions throughout the protein

      • Test accessibility to membrane-impermeable sulfhydryl reagents

    • Protease protection assays:

      • Treat membrane vesicles containing BCB4264_A4705 with proteases

      • Identify protected fragments through mass spectrometry

    • Reporter fusion approach:

      • Create fusion constructs with reporter proteins (GFP, PhoA, LacZ)

      • Position reporters at various points in the sequence

      • Activity patterns indicate cellular localization of each segment

  • Structural Analysis:

    • Electron crystallography of 2D crystals

    • Cryo-electron microscopy

    • X-ray crystallography (challenging for membrane proteins)

    • NMR spectroscopy on isotopically labeled protein

  • Validation in Native Membrane Environment:

    • Antibody accessibility studies with epitope-tagged versions expressed in B. cereus

    • Mass spectrometry-based techniques like MS footprinting

This multi-faceted approach would generate a comprehensive topology map, identifying transmembrane helices, loops, and their orientation relative to the membrane .

How does BCB4264_A4705 compare with homologous proteins in related bacterial species?

The UPF0756 family of membrane proteins, to which BCB4264_A4705 belongs, is distributed across various bacterial species. A comparative analysis reveals:

SpeciesProtein IdentifierSequence Identity (%)Sequence Similarity (%)Length (aa)
B. cereus (strain B4264)BCB4264_A4705 (B7HFA9)100100153
B. anthracis-~95-98*~97-99*~153*
B. thuringiensis-~92-96*~95-98*~153*
B. mycoides-~88-92*~92-95*~150-155*
B. weihenstephanensis-~85-90*~90-93*~150-155*

*Estimated range based on typical sequence conservation patterns in the B. cereus group; exact values would require specific sequence alignment .

Methodologically, comparative analyses should include:

  • Multiple sequence alignments

  • Phylogenetic tree construction

  • Analysis of conserved motifs and domains

  • Evaluation of selection pressure (dN/dS ratios)

  • Structural homology modeling based on any characterized homologs

These approaches provide insight into evolutionary conservation and potential functional significance of specific protein regions .

What methods can be used to explore potential roles of BCB4264_A4705 in bacterial stress response?

Investigating the involvement of BCB4264_A4705 in stress response mechanisms requires a systematic approach:

  • Expression Analysis Under Stress Conditions:

    • qRT-PCR to measure gene expression changes under various stressors:

      • Temperature extremes

      • pH fluctuations

      • Oxidative stress

      • Antimicrobial compounds

      • Nutrient limitation

    • Proteomic analysis to confirm translation under stress conditions

  • Genetic Manipulation Studies:

    • Gene knockout or knockdown (CRISPR-Cas9, antisense RNA)

    • Overexpression systems

    • Complementation assays

    • Site-directed mutagenesis of conserved residues

  • Phenotypic Characterization:

    • Growth curve analysis under stress conditions

    • Survival rate measurements

    • Morphological assessment via microscopy

    • Membrane integrity assays

    • Biofilm formation capabilities

  • Localization Studies:

    • Fluorescent protein fusions to track redistribution during stress

    • Immunolocalization with specific antibodies

    • Subcellular fractionation and Western blotting

  • Interactome Analysis:

    • Pull-down experiments under normal vs. stress conditions

    • Differential interaction mapping

    • Identification of stress-specific binding partners

Many membrane proteins in bacteria participate in stress sensing and response. As B. cereus is known to adapt to various environmental conditions during its pathogenic lifecycle, BCB4264_A4705 may play a role in these adaptation mechanisms .

What is the relationship between BCB4264_A4705 and the enterotoxins produced by Bacillus cereus?

While direct evidence linking BCB4264_A4705 to enterotoxin production or function is not explicitly stated in the available literature, this relationship can be investigated through several methodological approaches:

  • Co-expression Analysis:

    • Transcriptomic studies comparing expression patterns of BCB4264_A4705 with known enterotoxin genes (HBL, Nhe, CytK) under varying conditions

    • Assessment of gene expression correlation in clinical vs. environmental isolates

  • Functional Association Studies:

    • Generation of BCB4264_A4705 knockout strains and assessment of:

      • Enterotoxin gene expression levels

      • Enterotoxin protein secretion efficiency

      • Toxin activity in cellular and animal models

Bacillus cereus produces several enterotoxins, including the tripartite Heat-labile enterotoxin (HBL), Non-hemolytic enterotoxin (Nhe), and Cytotoxin K (CytK) . These toxins are critical virulence factors in B. cereus-induced gastrointestinal diseases.

HBL consists of three protein components (B, L₁, and L₂) that are necessary for maximal biological activity. It exhibits hemolytic activity, increases vascular permeability, causes necrosis in rabbit skin, and induces fluid accumulation in ligated rabbit ileal loops . The expression of HBL enterotoxin is influenced by various factors, including flagella formation and swarming differentiation .

As a membrane protein, BCB4264_A4705 could potentially be involved in:

  • Enterotoxin secretion pathways

  • Cell envelope integrity affecting toxin release

  • Sensing environmental cues that regulate toxin production

  • Membrane-associated signaling cascades controlling virulence gene expression

A comprehensive investigation would help establish whether BCB4264_A4705 plays a direct or indirect role in the enterotoxin-mediated pathogenicity of B. cereus .

What emerging technologies might advance the structural characterization of BCB4264_A4705?

Recent technological advances offer new opportunities for characterizing membrane proteins like BCB4264_A4705:

  • Cryo-Electron Microscopy (Cryo-EM):

    • Single-particle analysis for structure determination without crystallization

    • Tomography for visualizing proteins in membrane context

    • Methodological workflow:

      • Protein purification in suitable detergent or membrane mimetic

      • Vitrification on grids

      • Data collection with direct electron detectors

      • Image processing with motion correction and CTF estimation

      • 3D reconstruction and model building

  • Integrative Structural Biology Approaches:

    • Combining multiple data sources:

      • Low-resolution cryo-EM maps

      • Crosslinking-mass spectrometry data

      • EPR spectroscopy distance constraints

      • Hydrogen-deuterium exchange mass spectrometry

    • Computational modeling to integrate disparate datasets

  • AI-Enhanced Structure Prediction:

    • AlphaFold2 and RoseTTAFold adaptation for membrane proteins

    • Implementation strategy:

      • Generate multiple models with different parameters

      • Validate predictions against experimental data

      • Refine models using molecular dynamics simulations

  • Native Mass Spectrometry:

    • Analysis of intact membrane protein complexes

    • Determination of stoichiometry and binding partners

    • Technical approach:

      • Gentle extraction from membranes

      • Transfer to MS-compatible detergents

      • Ionization under carefully controlled conditions

  • Advanced Solid-State NMR:

    • MAS-NMR techniques for membrane proteins in lipid environments

    • Dynamic nuclear polarization (DNP) to enhance sensitivity

    • Experimental design:

      • Isotopic labeling (¹³C, ¹⁵N, ²H)

      • Reconstitution into lipid bilayers

      • Spectral acquisition at high magnetic fields

      • Integration with computational modeling

These technologies collectively address the historical challenges in membrane protein structural biology and would provide unprecedented insights into the structure-function relationship of BCB4264_A4705 .

How could genetic manipulation techniques be applied to elucidate the function of BCB4264_A4705?

Advanced genetic approaches offer powerful tools for functional characterization:

  • CRISPR-Cas9 Gene Editing:

    • Generation of precise knockout mutants

    • Introduction of point mutations to target specific domains

    • Creation of conditional expression systems

    • Implementation protocol:

      • Design of guide RNAs targeting BCB4264_A4705

      • Construction of repair templates for desired modifications

      • Transformation into B. cereus

      • Screening and verification of mutants

      • Phenotypic characterization under various conditions

  • Transposon Mutagenesis with Deep Sequencing (TnSeq):

    • Genome-wide identification of genetic interactions

    • Identification of synthetic lethal or synthetic sick interactions

    • Experimental approach:

      • Generate transposon library in wild-type and BCB4264_A4705-mutant backgrounds

      • Culture under selective conditions

      • Deep sequencing to identify insertion site frequencies

      • Computational analysis to identify genetic interactions

  • CRISPRi for Tunable Gene Repression:

    • Partial knockdown to study dosage effects

    • Temporal control of gene expression

    • Methodology:

      • Design of guide RNAs targeting the BCB4264_A4705 promoter

      • Expression of catalytically inactive Cas9 (dCas9)

      • Titratable repression through guide RNA abundance

      • Monitoring of phenotypic consequences

  • Protein Domain Mapping through Truncation Libraries:

    • Systematic generation of domain deletions

    • Identification of minimal functional units

    • Technical implementation:

      • PCR-based generation of truncation variants

      • Expression in native host or heterologous system

      • Functional complementation assays

      • Localization and interaction studies

These genetic approaches, combined with phenotypic assays focused on growth, stress response, and virulence, would provide comprehensive insights into the functional significance of BCB4264_A4705 in B. cereus biology .

What experimental strategies would be most effective for developing antibodies against BCB4264_A4705 for research applications?

Development of specific antibodies against membrane proteins like BCB4264_A4705 presents unique challenges requiring specialized approaches:

  • Antigen Design and Preparation:

    • Multiple antigen strategies:

      • Synthetic peptides from predicted extracellular loops

      • Recombinant protein fragments expressed in E. coli

      • Full-length protein in detergent micelles or nanodiscs

    • Optimization steps:

      • Hydrophilicity analysis to identify potential epitopes

      • Secondary structure prediction to select unstructured regions

      • Conservation analysis to target unique regions

  • Selection of Antibody Production Platform:

    • Conventional approaches:

      • Polyclonal antibodies from rabbits or chickens

      • Monoclonal antibodies from hybridoma technology

    • Advanced technologies:

      • Recombinant antibody development in llamas (nanobodies)

      • Phage display screening of synthetic libraries

      • Yeast surface display for affinity maturation

  • Validation Protocol Design:

    • Multiple validation techniques:

      • ELISA against purified protein

      • Western blotting under reducing and non-reducing conditions

      • Immunofluorescence microscopy with B. cereus

      • Immunoprecipitation of native protein

      • Verification with knockout controls

  • Application-Specific Optimization:

    • For structural studies:

      • Fab fragment generation for crystallography

      • Testing for conformational epitope recognition

    • For functional studies:

      • Screening for blocking/non-blocking antibodies

      • Epitope mapping to correlate with functional domains

Recent research has demonstrated success with recombinant antibodies developed in llamas against Bacillus cereus proteins, achieving excellent selectivity and sensitivity . This approach could be particularly valuable for BCB4264_A4705, as single-domain antibodies (nanobodies) often recognize conformational epitopes in membrane proteins with high specificity .

What analytical protocols are recommended for detecting BCB4264_A4705 expression in different Bacillus cereus strains?

Detection of BCB4264_A4705 expression across B. cereus strains requires robust and sensitive analytical approaches:

  • Transcriptional Analysis:

    • RT-qPCR protocol:

      • Design of primers specific to conserved regions of BCB4264_A4705

      • RNA extraction with specialized protocols for bacterial samples

      • cDNA synthesis with random hexamers or specific primers

      • Quantification relative to validated reference genes

    • RNA-Seq analysis:

      • Total RNA extraction and rRNA depletion

      • Library preparation and sequencing

      • Mapping to reference genomes

      • Differential expression analysis between strains

  • Protein Detection Methods:

    • Western blotting workflow:

      • Membrane fraction isolation from bacterial cultures

      • Solubilization in appropriate detergent

      • SDS-PAGE separation with optimal acrylamide percentage

      • Transfer to PVDF membranes

      • Detection with specific antibodies or anti-His antibodies for recombinant versions

    • Mass spectrometry-based proteomics:

      • Sample preparation with membrane protein enrichment

      • Tryptic digestion with detergent removal

      • LC-MS/MS analysis with data-dependent acquisition

      • Targeted MRM assays for quantification

  • Immunological Detection:

    • Immunofluorescence microscopy:

      • Cell fixation and permeabilization optimization

      • Blocking of non-specific binding sites

      • Primary antibody incubation with appropriate controls

      • Detection with fluorescently-labeled secondary antibodies

      • Confocal imaging for localization studies

    • Flow cytometry for population analysis:

      • Cell preparation with minimal aggregation

      • Antibody labeling protocols

      • Multi-parameter analysis for expression levels

  • Functional Reporter Systems:

    • Transcriptional fusions (promoter activity):

      • Fusion of BCB4264_A4705 promoter to reporter genes

      • Expression analysis under various growth conditions

      • Comparison between strains with different genetic backgrounds

    • Translational fusions (protein expression and localization):

      • C-terminal reporter protein fusions

      • Verification of functionality

      • Microscopy or activity-based detection

These analytical approaches provide complementary information about BCB4264_A4705 expression patterns and can reveal strain-specific differences in regulation and abundance .

How can researchers differentiate between closely related membrane proteins in the Bacillus cereus group when studying BCB4264_A4705?

Differentiating between homologous membrane proteins in the B. cereus group requires selective analytical strategies:

  • Sequence-Based Discrimination:

    • PCR-based approaches:

      • Design of primers targeting divergent regions

      • Optimization of annealing temperature for specificity

      • Restriction fragment length polymorphism (RFLP) analysis of amplicons

    • High-resolution melt curve analysis:

      • Amplification with conserved primers

      • Melting profile analysis for species-specific patterns

      • Calibration with reference strains

  • Protein-Level Differentiation:

    • Epitope mapping for antibody development:

      • Identification of unique peptide sequences

      • Production of antibodies against divergent regions

      • Validation using recombinant proteins from each species

    • Mass spectrometry-based approaches:

      • Identification of species-specific tryptic peptides

      • Development of MRM assays targeting unique peptides

      • Database creation with species-specific spectral libraries

  • Functional Characterization:

    • Species-specific expression patterns:

      • Comparative transcriptomics under standardized conditions

      • Identification of differential regulation patterns

    • Protein-protein interaction profiles:

      • Pull-down assays with species-specific proteins

      • Network analysis to identify unique interaction partners

  • Bioinformatic Approaches:

    • Development of computational tools:

      • Hidden Markov Models trained on species-specific sequences

      • Machine learning algorithms for classification based on multiple features

      • Integration of genomic context information

These approaches provide multiple layers of discrimination to ensure accurate identification and characterization of BCB4264_A4705 across the B. cereus group, which is critical given the high genetic similarity among these species .

What are the methodological considerations when using BCB4264_A4705 as a potential biomarker for Bacillus cereus identification?

Utilizing BCB4264_A4705 as a biomarker for B. cereus identification requires careful methodological considerations:

  • Specificity Assessment:

    • Comprehensive sequence comparison across:

      • All B. cereus group species

      • Closely related Bacillus species

      • Common environmental bacteria

    • Cross-reactivity testing:

      • Panel screening with recombinant proteins

      • Whole-cell testing with detection reagents

      • Statistical analysis of false positive/negative rates

  • Detection Method Development:

    • Antibody-based detection strategies:

      • ELISA development with optimized capture and detection antibodies

      • Lateral flow assay design for rapid field testing

      • Flow cytometry protocols for bacterial identification

    • Nucleic acid-based detection:

      • PCR primer and probe design targeting unique regions

      • LAMP (Loop-mediated isothermal amplification) protocols

      • Microarray probes for multiplex detection

  • Sensitivity Optimization:

    • Signal amplification strategies:

      • Enzymatic amplification in immunoassays

      • Digital PCR for low-copy detection

      • Sample preparation optimization to concentrate target

    • Multi-analyte profiling approaches:

      • xMAP technology implementation

      • Multiplexing with other B. cereus biomarkers

      • Algorithmic integration of multiple signals

  • Validation in Complex Matrices:

    • Food sample testing protocols:

      • Matrix-specific extraction methods

      • Internal control implementation

      • Spike recovery studies

    • Environmental sample procedures:

      • Soil and water sample preparation

      • Inhibitor removal strategies

      • Limit of detection determination

Recent research has demonstrated successful application of multiplexed detection systems for B. cereus identification using xMAP technology, achieving sensitivity between 10² and 10⁵ spores/mL with excellent selectivity . Similar approaches could be adapted for BCB4264_A4705 as a biomarker, particularly in combination with other targets for increased confidence in identification .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.