Recombinant Bacillus cereus UPF0756 membrane protein BCE33L4336 (BCE33L4336)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them during order placement, and we will fulfill your request.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributors for specific delivery timeframes.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer components, temperature, and the protein's inherent stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
BCE33L4336; UPF0756 membrane protein BCE33L4336
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-153
Protein Length
full length protein
Species
Bacillus cereus (strain ZK / E33L)
Target Names
BCE33L4336
Target Protein Sequence
MISQSTLFLFILLIIGLIAKNQSLTVAIGVLFLLKFTFLGDKVFPYLQTKGINLGVTVIT IAVLVPIATGEIGFKQLGEAAKSYYAWIALASGVAVALLAKGGVQLLTTDPHITTALVFG TIIAVALFNGVAVGPLIGAGIAYAVMSIIQMFK
Uniprot No.

Target Background

Database Links
Protein Families
UPF0756 family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is Bacillus cereus and what is known about its membrane proteins?

Bacillus cereus is a Gram-positive, facultatively anaerobic, spore-forming bacterium belonging to the Bacillus cereus sensu lato group, which includes other closely related species such as B. anthracis and B. thuringiensis . It has a genome size of approximately 5,335 kb with a G+C content of ~35% . The bacterium contains numerous membrane proteins that play critical roles in virulence, antimicrobial resistance, and cellular physiology. BCE33L4336, classified as an UPF0756 family membrane protein, represents one of the many membrane-associated proteins encoded in the B. cereus genome.

B. cereus produces various virulence factors including enterotoxins such as hemolysin BL (HBL), non-hemolytic enterotoxin (NHE), enterotoxin FM (EntFM), and cytotoxin K (CytK) . These virulence factors contribute to the pathogen's ability to cause food poisoning and more severe infections including pneumonia, bacteremia, endophthalmitis, and central nervous system infections .

What are the optimal growth conditions for culturing B. cereus for membrane protein studies?

When culturing B. cereus for membrane protein studies, researchers should consider the following methodological approach:

Growth media composition:

  • Brain Heart Infusion (BHI) broth provides excellent yields for B. cereus cultivation

  • Luria-Bertani (LB) medium supplemented with 0.5% glucose can enhance growth

  • Defined minimal media may be used when specific nutrient limitations are required

Growth conditions:

  • Temperature: 30-37°C for mesophilic strains (note that psychrotrophic strains grow below 10°C but not at 37°C)

  • pH: 6.0-7.0

  • Aeration: Moderate shaking (150-200 rpm) for aerobic growth

  • Growth phase: Late exponential phase typically provides optimal membrane protein expression

For BCE33L4336 expression studies, monitoring growth using optical density measurements at 600 nm (OD600) is recommended, with harvest typically occurring at OD600 of 0.8-1.0 for optimal membrane protein yield.

Which expression systems are most effective for producing recombinant B. cereus membrane proteins?

Several expression systems can be employed for recombinant production of BCE33L4336, each with distinct advantages:

Expression SystemAdvantagesDisadvantagesRecommended for BCE33L4336
E. coli BL21(DE3)High yield, well-established protocols, economicalMay form inclusion bodies, potential toxicityInitial expression trials
E. coli C41(DE3)/C43(DE3)Designed for toxic membrane proteinsLower yields than BL21When standard strains fail
Bacillus subtilisNative-like membrane environment, efficient secretionMore complex genetic manipulationHigher-quality functional studies
Cell-free expressionAvoids toxicity issues, direct incorporation into liposomesExpensive, lower yieldsDifficult-to-express proteins

For BCE33L4336, a methodological approach would include:

  • Construct design with appropriate fusion tags (His6, MBP, or SUMO) to aid solubility and purification

  • Codon optimization for the selected expression host

  • Incorporation of inducible promoters (IPTG-inducible T7 or arabinose-inducible araBAD)

  • Temperature optimization (often lowering to 16-20°C post-induction)

  • Addition of membrane protein-specific chaperones or foldases when necessary

What are effective strategies for optimizing the solubility of recombinant BCE33L4336?

Membrane proteins like BCE33L4336 present solubility challenges. The following methodological approaches can enhance solubility:

  • Fusion partner screening:

    • MBP (maltose-binding protein) fusion at N-terminus

    • SUMO fusion for enhanced folding

    • Thioredoxin fusion for disulfide bond formation

  • Expression condition optimization:

    • Reduce expression temperature to 16-20°C post-induction

    • Use lower inducer concentrations (0.1-0.5 mM IPTG instead of 1 mM)

    • Extend expression time (16-24 hours) at lower temperatures

  • Additives to expression media:

    • Glycerol (5-10%) to stabilize hydrophobic domains

    • Specific metal ions if the protein contains metal-binding domains

    • Osmolytes like sucrose (5%) or betaine (1 mM)

  • Solubilization approaches:

    • Screen detergent panels (DDM, LDAO, LMNG) for optimal extraction

    • Employ bicelles or nanodiscs for native-like lipid environments

    • Consider amphipols for enhanced stability

What techniques are most reliable for detecting and quantifying BCE33L4336 in experimental samples?

Reliable detection and quantification of BCE33L4336 can be achieved through multiple methods:

  • Immunological techniques:

    • Western blotting using anti-His tag antibodies (if His-tagged) or custom antibodies against BCE33L4336

    • ELISA for quantitative analysis in complex samples

    • Immunofluorescence for localization studies

  • Mass spectrometry approaches:

    • LC-MS/MS for identification and relative quantification

    • Selected reaction monitoring (SRM) for absolute quantification

    • MALDI-TOF for rapid screening

  • Fluorescence-based methods:

    • GFP fusion proteins for live-cell imaging and localization studies, similar to approaches used with phage proteins

    • Fluorescence microscopy for spatial distribution analysis

  • Activity-based assays:

    • If enzymatic activity is known, functional assays can provide indirect quantification

    • Ligand binding assays if binding partners are identified

For bacterial capture and detection methodologies, researchers have successfully employed membrane-associated proteins as biointerfaces in lateral flow assays, which could potentially be adapted for BCE33L4336 studies .

How can researchers effectively study the structure-function relationship of BCE33L4336?

A systematic approach to studying the structure-function relationship of BCE33L4336 includes:

  • Structural analysis methods:

    • X-ray crystallography (challenging for membrane proteins)

    • Cryo-electron microscopy for higher-resolution structures

    • NMR spectroscopy for dynamic studies

    • Computational modeling based on homologous proteins

  • Functional characterization approaches:

    • Site-directed mutagenesis of predicted functional residues

    • Deletion mapping of domains

    • Cross-linking studies to identify interaction partners

    • Electrophysiology if channel/transport functions are suspected

  • Correlation methodologies:

    • Structure-guided mutagenesis followed by functional assays

    • Molecular dynamics simulations to predict conformational changes

    • Evolutionary analysis to identify conserved functional residues

  • In vivo relevance studies:

    • Knockout/knockdown studies in B. cereus

    • Complementation assays with mutant variants

    • Virulence assessment in infection models if BCE33L4336 is implicated in pathogenicity

What role might BCE33L4336 play in B. cereus virulence and pathogenicity?

While specific functions of BCE33L4336 are not directly described in the provided literature, membrane proteins in B. cereus often contribute to virulence through several mechanisms:

  • Potential roles in toxin secretion:

    • B. cereus produces various toxins including HBL, NHE, EntFM, and CytK

    • Membrane proteins may form part of secretion systems for these toxins

    • The prevalence of NHE genes (89-99%) and HBL genes (39-50%) in B. cereus isolates suggests the importance of toxin production and secretion

  • Possible involvement in adhesion and invasion:

    • Membrane proteins often mediate bacterial attachment to host cells

    • BCE33L4336 might contribute to the bacterium's ability to cause severe infections beyond food poisoning, such as bacteremia and CNS infections

  • Antimicrobial resistance connection:

    • B. cereus produces β-lactamases conferring resistance to most β-lactam antibiotics

    • Membrane proteins can function as efflux pumps or modify membrane permeability to antibiotics

    • Over 82% of B. cereus isolates show resistance to β-lactam antibiotics, while fewer are resistant to cefotetan (13.59%) and imipenem (0.27%)

  • Experimental approaches to investigate BCE33L4336 virulence roles:

    • Gene knockout studies followed by virulence assessment

    • Protein localization during infection using fluorescently tagged variants

    • Transcriptomics to determine expression patterns during infection stages

    • Protein-protein interaction studies to identify virulence-associated binding partners

How might BCE33L4336 interact with host immune systems during infection?

Membrane proteins like BCE33L4336 potentially interact with host immune systems in several ways:

  • Pattern recognition receptor (PRR) interactions:

    • As a membrane protein, BCE33L4336 may contain pathogen-associated molecular patterns (PAMPs)

    • These PAMPs could be recognized by host Toll-like receptors (TLRs) or other PRRs

    • Such interactions may trigger inflammatory responses or be involved in immune evasion

  • Methodology for studying immune interactions:

    • Recombinant protein stimulation of immune cells (macrophages, dendritic cells)

    • Cytokine profiling following exposure to purified BCE33L4336

    • Pull-down assays to identify direct immune receptor binding

    • In vivo infection models comparing wild-type and BCE33L4336-deficient strains

  • Potential immunomodulatory functions:

    • Inhibition of complement activation

    • Interference with phagocytosis

    • Modulation of cytokine production

    • Alteration of antigen presentation

What are the optimal methods for purifying recombinant BCE33L4336 while maintaining its native conformation?

Purification of membrane proteins like BCE33L4336 requires specialized approaches:

  • Membrane isolation and solubilization:

    • Differential centrifugation to isolate membrane fractions

    • Detergent screening panel (typically 8-10 different detergents)

    • Solubilization optimization (detergent:protein ratio, temperature, time)

    Detergent ClassExamplesOptimal ConcentrationBest For
    Mild non-ionicDDM, LMNG1-2% for extraction, 0.02-0.05% for purificationMaintaining native structure
    ZwitterionicLDAO, Fos-choline1-2%Higher extraction efficiency
    Bile salt derivativesCHAPS, cholate0.5-1%Versatile extraction
  • Affinity chromatography strategies:

    • Immobilized metal affinity chromatography (IMAC) for His-tagged protein

    • Optimization of imidazole concentrations (10-40 mM wash, 250-500 mM elution)

    • On-column detergent exchange if needed

  • Secondary purification steps:

    • Size exclusion chromatography to remove aggregates and ensure monodispersity

    • Ion exchange chromatography for further purification

    • Lipid addition during purification to maintain stability

  • Quality control assessments:

    • Dynamic light scattering to confirm monodispersity

    • Circular dichroism to verify secondary structure

    • Thermal shift assays to optimize buffer conditions

What crystallization techniques have proven successful for membrane proteins similar to BCE33L4336?

Crystallization of membrane proteins presents significant challenges. For proteins like BCE33L4336, these methodological approaches have proven useful:

  • Traditional vapor diffusion with modifications:

    • Detergent screening is critical (typically requires testing 6-10 different detergents)

    • Lipid cubic phase (LCP) crystallization for maintaining native-like environment

    • Bicelle-based crystallization combining lipids and detergents

    • Addition of specific lipids that co-purify with the protein

  • Crystal optimization strategies:

    • Antibody fragment (Fab) co-crystallization to increase polar surfaces

    • Fusion with crystallization chaperones (T4 lysozyme, BRIL)

    • Surface entropy reduction through mutation of flexible loops

    • Screening various truncation constructs to remove disordered regions

  • Alternative structural approaches when crystallization fails:

    • Cryo-electron microscopy (particularly suitable for larger membrane proteins)

    • NMR spectroscopy for smaller membrane proteins or specific domains

    • Hydrogen-deuterium exchange mass spectrometry for dynamics and interactions

    • Molecular modeling based on homologous structures

What methodologies are most effective for determining the functional role of BCE33L4336 in B. cereus physiology?

To determine the physiological function of BCE33L4336, researchers should consider these methodological approaches:

  • Genetic manipulation strategies:

    • Gene knockout using CRISPR-Cas9 or homologous recombination

    • Conditional expression systems to study essential genes

    • Complementation studies to confirm phenotypes

    • Site-directed mutagenesis of predicted functional residues

  • Phenotypic characterization:

    • Growth kinetics under various conditions (temperature, pH, osmotic stress)

    • Antibiotic susceptibility testing (particularly to β-lactams)

    • Virulence factor production assessment

    • Biofilm formation capacity

  • Molecular interaction studies:

    • Pull-down assays to identify protein-protein interactions

    • Two-hybrid screens for interaction partners

    • Co-immunoprecipitation from native membranes

    • Cross-linking studies followed by mass spectrometry

  • Comparative analysis with other Bacillus species:

    • Functional comparison with homologs in related species like B. anthracis and B. thuringiensis

    • Complementation studies across species

    • Evolutionary analysis of protein conservation

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.