Recombinant Bacillus cereus UPF0756 membrane protein BCG9842_B0533 (BCG9842_B0533)

What is the basic structural information about Bacillus cereus UPF0756 membrane protein BCG9842_B0533?

BCG9842_B0533 is a membrane protein from Bacillus cereus with 153 amino acids. Its complete amino acid sequence is: MISQSTLFLFILLIIGLIAKNQSLTVAIGVLFLLKFTFLGDKVFPYLQTKGINLGVTVITIAVLVPIATGEIGFKQLGEAAKSYYAWIALASGVAVALLAKGGVQLLTTDPHITTALVFGTIIAVALFNGVAVGPLIGAGIAYAVMSIIQMFK . The protein belongs to the UPF0756 family, and its UniProt ID is B7IJZ3. As a membrane protein, it contains hydrophobic regions that anchor it within the bacterial cell membrane. Based on the amino acid sequence analysis, this protein likely contains multiple transmembrane domains, consistent with its classification as a membrane protein .

How does the recombinant version of BCG9842_B0533 differ from the native protein?

The recombinant version of BCG9842_B0533 differs from the native protein primarily through the addition of an N-terminal His-tag, which facilitates purification using affinity chromatography. While the native protein exists within the membrane of Bacillus cereus, the recombinant version is heterologously expressed in E. coli . This expression system change may result in altered post-translational modifications and protein folding characteristics compared to the native environment. Additionally, the recombinant form is typically supplied as a lyophilized powder rather than in its natural membrane-embedded state . Researchers should consider these differences when designing experiments and interpreting results related to protein function and interaction studies.

What is known about the biological function of UPF0756 family membrane proteins in Bacillus species?

The UPF0756 membrane protein family remains largely uncharacterized in terms of specific biological functions. Unlike well-studied proteins such as EntD in Bacillus cereus, which has been shown to regulate numerous cellular processes including metabolism, cell structure, motility, and virulence , the UPF0756 family has not been extensively characterized. Based on comparative genomics approaches and the patterns observed in other membrane proteins from Bacillus species, these proteins may be involved in:

• Cell membrane integrity maintenance

• Transport of specific molecules across the membrane

• Signaling pathways related to environmental adaptation

• Potential roles in stress response mechanisms

Research utilizing gene knockout studies, protein-protein interaction analyses, and comparative proteomics would be necessary to elucidate the specific functions of BCG9842_B0533. The significant regulatory impact observed with other Bacillus membrane proteins suggests potential importance in cellular physiology .

What expression systems are optimal for producing recombinant BCG9842_B0533 protein?

While the commercial version of BCG9842_B0533 is expressed in E. coli , researchers should consider multiple expression systems based on their specific experimental needs:

Bacillus subtilis merits special consideration as it offers specialized advantages for expressing proteins from related Bacillus species. Its GRAS status and innate ability to incorporate exogenous DNA make it an excellent platform for heterologous protein expression . The extensive genetic engineering tools available for B. subtilis, including various plasmids, promoter systems, and secretion mechanisms, provide researchers with multiple strategies for optimizing expression .

What purification strategies are most effective for isolating membrane proteins like BCG9842_B0533?

Purifying membrane proteins like BCG9842_B0533 requires specialized approaches to deal with their hydrophobic nature:

• Initial Extraction: Use appropriate detergents (DDM, LDAO, or Triton X-100) to solubilize the membrane protein while maintaining native structure.

• Affinity Chromatography: Utilize the N-terminal His-tag for immobilized metal affinity chromatography (IMAC) with Ni-NTA resin. Optimize imidazole concentration in wash and elution buffers to reduce non-specific binding while maximizing target protein recovery .

• Secondary Purification: Implement size exclusion chromatography (SEC) to separate protein aggregates and achieve higher purity.

• Detergent Exchange: Consider exchanging harsh detergents used for extraction with milder detergents or amphipols for downstream functional studies.

• Storage Optimization: For long-term storage, the lyophilized form with 6% trehalose in Tris/PBS-based buffer (pH 8.0) maintains stability . For working aliquots, reconstitute to 0.1-1.0 mg/mL and add 5-50% glycerol, then store at -20°C/-80°C to prevent freeze-thaw damage .

When handling the purified protein, minimize repeated freeze-thaw cycles and consider maintaining small working aliquots at 4°C for up to one week for active experiments .

How can researchers overcome expression challenges specific to hydrophobic membrane proteins from Bacillus species?

Membrane proteins present unique expression challenges due to their hydrophobic domains. For BCG9842_B0533 and similar proteins, consider these advanced strategies:

• Optimize Codon Usage: Analyze and optimize codons for the expression host to improve translation efficiency.

• Regulate Expression Rate: Use tunable promoter systems rather than strong constitutive promoters to prevent aggregation during high-level expression.

• Engineer Fusion Partners: Add solubility-enhancing tags (MBP, SUMO, or GST) in addition to the His-tag to improve folding and solubility.

• Membrane Mimetics: Incorporate membrane mimetics (nanodiscs, liposomes) during or after purification to provide a native-like environment.

• Expression Temperature Modulation: Lower expression temperature (16-25°C) to slow protein synthesis and improve folding quality.

• Consider Bacillus subtilis Expression: For particularly challenging cases, B. subtilis offers advantages as it can efficiently secrete proteins and has similar membrane composition to B. cereus . Strategies developed for B. subtilis, including self-inducing expression systems and signal peptide-based secretion systems, may prove valuable .

• Cell-Free Expression: For proteins that remain toxic or poorly expressed in cellular systems, cell-free expression systems based on B. subtilis extracts can provide an alternative approach.

What methods are recommended for studying the membrane topology of BCG9842_B0533?

Determining the membrane topology of BCG9842_B0533 requires complementary experimental approaches:

• Computational Prediction: Start with hydropathy analysis and transmembrane domain prediction using tools like TMHMM, Phobius, or TOPCONS.

• Cysteine Scanning Mutagenesis: Introduce cysteine residues at various positions and test their accessibility to membrane-impermeable sulfhydryl reagents.

• Protease Protection Assays: Test accessibility of different regions to proteases in intact membranes versus disrupted membranes to identify protected domains.

• Fluorescence Techniques:

  • FRET analysis with strategically placed fluorophores

  • Site-directed fluorescence labeling to monitor environment-dependent changes

• Epitope Mapping: Insert epitope tags at various positions and assess accessibility using antibodies.

• Structural Biology Approaches:

  • Cryo-electron microscopy for larger membrane protein complexes

  • X-ray crystallography or NMR spectroscopy (challenging but potentially informative)

For BCG9842_B0533 specifically, compare experimental results with structural data from related UPF0756 family proteins to validate findings and build a comprehensive topological model.

How can researchers determine if BCG9842_B0533 functions as part of a larger protein complex?

To investigate whether BCG9842_B0533 functions within a protein complex, employ these methodological approaches:

• Native Blue Native PAGE: Analyze membrane extracts using non-denaturing conditions to preserve protein-protein interactions.

• Co-immunoprecipitation: Use antibodies against the His-tag or the protein itself to pull down potential interacting partners, followed by mass spectrometry identification.

• Crosslinking Studies: Apply membrane-permeable crosslinkers followed by SDS-PAGE and mass spectrometry to identify proximal proteins.

• Bacterial Two-Hybrid Systems: Adapt bacterial two-hybrid screening to test specific protein interaction hypotheses.

• Proteomics Approach: Compare the proteome profiles of wild-type and BCG9842_B0533 knockout strains to identify proteins with correlated expression patterns, similar to approaches used for EntD protein studies .

• Comparative Genomics: Analyze gene neighborhood conservation across different Bacillus species to identify consistently co-located genes that may encode interacting proteins.

• Functional Complementation: Test whether the introduction of BCG9842_B0533 can restore phenotypes in strains lacking other membrane proteins to identify functional relationships.

What techniques are most reliable for investigating the membrane dynamics and lipid interactions of BCG9842_B0533?

Understanding membrane dynamics and lipid interactions requires specialized biophysical approaches:

• Fluorescence Recovery After Photobleaching (FRAP): Measure lateral mobility of fluorescently labeled BCG9842_B0533 within membranes.

• Solid-State NMR: Provide atomic-level information about protein-lipid interactions in membrane environments.

• Differential Scanning Calorimetry (DSC): Assess how BCG9842_B0533 affects membrane phase transitions and stability.

• Atomic Force Microscopy (AFM): Visualize BCG9842_B0533 organization within membrane bilayers at nanometer resolution.

• Molecular Dynamics Simulations: Complement experimental data with simulations of BCG9842_B0533 behavior in different membrane compositions.

• Lipidomics Analysis: Compare lipid profiles in wild-type versus BCG9842_B0533 knockout strains to identify specifically enriched or depleted lipid species.

• Reconstitution Studies: Systematically vary lipid composition in reconstituted proteoliposomes to identify specific lipid requirements for protein function.

These approaches should be combined to develop a comprehensive understanding of how BCG9842_B0533 interacts with and potentially modifies the bacterial membrane environment.

How does the BCG9842_B0533 protein potentially contribute to Bacillus cereus pathogenicity?

Although specific pathogenicity roles for BCG9842_B0533 have not been directly established, parallels can be drawn from other Bacillus cereus membrane proteins to hypothesize potential contributions:

• Possible Virulence Connection: Other membrane proteins in B. cereus, such as EntD, significantly impact virulence-associated functions. EntD disruption affects metabolism, cell structure, antioxidative ability, cell motility, and toxin production . As a membrane protein, BCG9842_B0533 may similarly participate in cellular processes relevant to pathogenicity.

• Regulatory Network Integration: The deletion of EntD in B. cereus affected 308 proteins in the cellular proteome and 79 proteins in the exoproteome . BCG9842_B0533 might similarly participate in regulatory networks affecting multiple virulence factors.

• Methodological Approach to Testing Pathogenicity Roles:

  • Generate knockout mutants using techniques similar to those described for EntD

  • Assess impact on growth kinetics, cell morphology, and motility

  • Compare proteome profiles between wild-type and mutant strains

  • Evaluate cytotoxicity in appropriate cell culture models

  • Test virulence in suitable animal models

• Potential Specific Functions: Based on membrane localization, BCG9842_B0533 could be involved in:

  • Adhesion to host tissues

  • Resistance to host defense mechanisms

  • Sensing environmental signals during infection

  • Transport of nutrients or export of virulence factors

Research designs targeting these hypotheses could provide valuable insights into the role of this understudied membrane protein in B. cereus pathogenicity.

What comparative analysis approaches are useful for understanding the evolutionary conservation of BCG9842_B0533 across Bacillus species?

To understand the evolutionary significance of BCG9842_B0533, implement these comparative approaches:

• Phylogenetic Analysis:

  • Construct phylogenetic trees of UPF0756 family proteins across Bacillus species

  • Identify patterns of conservation that correlate with specific bacterial phenotypes or ecological niches

  • Compare evolutionary rates with other membrane proteins

• Sequence Conservation Mapping:

  • Align multiple sequences of UPF0756 family proteins

  • Map conservation scores onto predicted structural models

  • Identify highly conserved residues likely critical for function

• Genomic Context Analysis:

  • Examine gene neighborhood conservation across species

  • Identify co-evolved genes that may function together with BCG9842_B0533

  • Look for horizontal gene transfer events that may indicate adaptive importance

• Structure-Based Comparison:

  • Use homology modeling based on related proteins with known structures

  • Compare predicted structures across different Bacillus species

  • Identify structurally conserved motifs that suggest functional importance

• Experimental Validation:

  • Test complementation of knockout strains with orthologs from related species

  • Analyze phenotypic differences when expressing BCG9842_B0533 variants from diverse Bacillus species

This multi-faceted approach can reveal the evolutionary history and functional significance of BCG9842_B0533 across the Bacillus genus.

What analytical methods should be employed to characterize potential post-translational modifications of BCG9842_B0533?

Post-translational modifications (PTMs) can significantly impact protein function. For BCG9842_B0533, employ these analytical approaches:

• Mass Spectrometry-Based Proteomics:

  • Use high-resolution MS with multiple fragmentation techniques (CID, ETD, HCD)

  • Implement enrichment strategies for specific PTMs (phosphopeptides, glycopeptides)

  • Compare PTM profiles between native and recombinant proteins

• Site-Directed Mutagenesis:

  • Mutate predicted PTM sites to non-modifiable residues

  • Assess functional consequences to determine PTM significance

  • Create phosphomimetic mutations to simulate constitutive phosphorylation

• Western Blotting with PTM-Specific Antibodies:

  • Use antibodies targeting common PTMs (phosphorylation, acetylation, etc.)

  • Employ PTM-specific stains like Pro-Q Diamond for phosphoproteins

• In Vitro Modification Assays:

  • Incubate purified BCG9842_B0533 with kinases, acetyltransferases, or other modification enzymes

  • Monitor changes in protein mobility or activity

• Dynamic PTM Analysis:

  • Track changes in modification patterns under different environmental conditions

  • Assess temporal dynamics of modifications during bacterial growth phases

These approaches provide a comprehensive understanding of how PTMs might regulate BCG9842_B0533 function in different cellular contexts.

How can CRISPR-Cas9 technology be applied to study BCG9842_B0533 function in Bacillus cereus?

CRISPR-Cas9 provides powerful tools for studying BCG9842_B0533:

• Genome Editing Strategies:

  • Complete gene knockout to assess loss-of-function phenotypes

  • Precise point mutations to test specific amino acid contributions

  • Insertion of epitope tags for localization studies

  • Creation of conditional expression systems

• Methodological Considerations for Bacillus Species:

  • Adapt CRISPR-Cas9 plasmids with temperature-sensitive origin of replication

  • Optimize codon usage for sgRNA expression in Bacillus cereus

  • Consider using Cas9 nickase approach to reduce off-target effects

  • Implement homology-directed repair templates with sufficient homology arms (500-1000 bp)

• Advanced Applications:

  • CRISPRi for transient, tunable gene repression

  • CRISPRa for enhanced expression studies

  • CRISPR base editors for precise nucleotide changes without DSBs

  • Multiplexed targeting to assess genetic interactions

• Validation Approaches:

  • Confirm edits by sequencing

  • Assess mRNA and protein levels

  • Use complementation to verify phenotype specificity

  • Compare with traditional gene deletion methods

This modern genetic engineering approach overcomes limitations of traditional methods, allowing more precise and rapid functional characterization of BCG9842_B0533.

What experimental approaches are recommended for studying potential interactions between BCG9842_B0533 and the host immune system?

Understanding potential interactions between BCG9842_B0533 and host immunity requires multi-faceted approaches:

• Immune Cell Stimulation Assays:

  • Expose purified BCG9842_B0533 to macrophages, dendritic cells, and neutrophils

  • Measure cytokine/chemokine production (IL-1β, TNF-α, IL-6)

  • Assess activation markers using flow cytometry

  • Compare responses to wild-type and mutant proteins

• Pattern Recognition Receptor (PRR) Interaction Studies:

  • Test binding to purified TLR2, TLR4, and other relevant PRRs

  • Use reporter cell lines expressing individual PRRs

  • Implement ELISA-based binding assays with recombinant receptors

• In Vivo Models:

  • Compare immune responses to wild-type and BCG9842_B0533-deficient B. cereus strains

  • Utilize knockout mice lacking specific immune components

  • Track bacterial clearance and immune cell recruitment

• Antigen Presentation Assessment:

  • Investigate if BCG9842_B0533 peptides are presented by MHC molecules

  • Test T-cell recognition using specific assays

  • Examine antibody production against BCG9842_B0533 during infection

• Systems Immunology Approach:

  • Implement transcriptomics of host cells exposed to BCG9842_B0533

  • Conduct proteomics analysis of immune cells post-exposure

  • Develop computational models of host-pathogen interactions

These approaches will help determine whether BCG9842_B0533 plays an active role in modulating host immunity during B. cereus infection.

What are the most promising biotechnological applications for recombinant BCG9842_B0533 protein in current research?

Recombinant BCG9842_B0533 offers several potential biotechnological applications:

• Vaccine Development:

  • As a candidate antigen for subunit vaccines against B. cereus

  • As a carrier protein for conjugate vaccines

  • For development of attenuated live vaccines with modified BCG9842_B0533

• Diagnostic Applications:

  • Development of antibody-based detection systems for B. cereus

  • Creation of aptamer-based biosensors using BCG9842_B0533 as a target

  • Implementation in multiplex assays for bacterial identification

• Membrane Protein Research Platform:

  • As a model system for studying bacterial membrane protein structure

  • For developing novel membrane protein crystallization techniques

  • To optimize membrane protein expression and purification protocols

• Drug Discovery:

  • Use in high-throughput screening assays to identify novel antimicrobials

  • As a target for structure-based drug design

  • For development of inhibitors that could attenuate B. cereus virulence

• Biotechnology Tools:

  • Engineering as a membrane anchor for surface display technologies

  • Adaptation as a reporter protein for membrane studies

  • Development as a fusion partner for membrane protein production

These applications leverage the unique properties of BCG9842_B0533 and could provide valuable research tools and potential clinical applications.

What are the most common technical challenges when working with recombinant BCG9842_B0533 and how can they be addressed?

Researchers frequently encounter these challenges when working with BCG9842_B0533:

When troubleshooting expression systems specifically, consider the advanced expression strategies developed for B. subtilis systems, which include engineering of constitutive or double promoters and self-inducing expression systems with secretion capabilities .

How can researchers validate the proper folding and functionality of recombinant BCG9842_B0533?

Validating proper folding and functionality is crucial for membrane proteins:

• Biophysical Characterization:

  • Circular dichroism (CD) spectroscopy to assess secondary structure content

  • Fluorescence spectroscopy to evaluate tertiary structure integrity

  • Thermal shift assays to determine protein stability

  • Size exclusion chromatography coupled with multi-angle light scattering (SEC-MALS) to assess oligomeric state

• Functional Assays (based on hypothesized functions):

  • For transport proteins: Liposome-based transport assays

  • For enzymes: Activity assays with appropriate substrates

  • For binding proteins: Ligand binding assays using fluorescence or isothermal titration calorimetry

• Structural Validation:

  • Limited proteolysis to assess compact folding

  • Hydrogen-deuterium exchange mass spectrometry to probe structural dynamics

  • Negative-stain electron microscopy to visualize protein particles

• Comparative Analysis:

  • Compare properties with native protein extracted from B. cereus

  • Benchmark against characterized homologs from related species

• In vivo Complementation:

  • Test if recombinant protein can restore phenotypes in knockout strains

These validation approaches ensure that experimental findings reflect the protein's native properties rather than artifacts of recombinant production.

What data analysis pipelines are recommended for interpreting proteomics data related to BCG9842_B0533 interaction networks?

For analyzing BCG9842_B0533 interaction networks, implement these data analysis approaches:

• Proteomics Data Processing Pipeline:

  • Quality control and filtering of raw mass spectrometry data

  • Protein identification using database search engines (MASCOT, SEQUEST)

  • Quantification using label-free or labeled (SILAC, TMT) approaches

  • Statistical analysis to identify significantly changed proteins

• Interaction Network Construction:

  • Primary interaction identification using affinity purification-mass spectrometry data

  • Filtering against appropriate negative controls

  • Scoring interactions based on specificity and abundance

  • Network visualization using tools like Cytoscape or STRING

• Functional Enrichment Analysis:

  • GO term enrichment to identify biological processes affected

  • KEGG pathway mapping to place interactions in metabolic context

  • Domain-based analysis to identify recurring protein interaction motifs

• Comparative Network Analysis:

  • Compare BCG9842_B0533 interactome with published data on related proteins

  • Identify conserved and unique interaction patterns

  • Integrate with EntD-dependent proteome changes for comprehensive understanding

• Validation Strategy Design:

  • Prioritize interactions for validation based on network analysis

  • Design targeted experiments to confirm key interactions

  • Implement systems biology models to predict functional consequences

This systematic approach to proteomics data analysis provides a comprehensive view of how BCG9842_B0533 functions within the complex protein interaction networks of B. cereus.