Recombinant Bacillus clausii Lipoprotein signal peptidase (lspA)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for fulfillment based on your requirements.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, and can be used as a reference.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and protein stability.
Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type will be determined during the production process. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
lspA; ABC2340; Lipoprotein signal peptidase; Prolipoprotein signal peptidase; Signal peptidase II; SPase II
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-151
Protein Length
full length protein
Species
Bacillus clausii (strain KSM-K16)
Target Names
lspA
Target Protein Sequence
MAYIVALIIIALDQLTKWLVVTSMELGERIPIIDQVLYLYSHRNTGAAFGILQGQMWFFY VVTTIIVGVIIYLIQTEAKGNRLLKIALGLVLGGAIGNFIDRLLRQEVVDFIDTFGDFPI FNIADSALTIGVGLFLLNILIQGRNEKRSTR
Uniprot No.

Target Background

Function

This protein specifically catalyzes the removal of signal peptides from prolipoproteins.

Database Links

KEGG: bcl:ABC2340

STRING: 66692.ABC2340

Protein Families
Peptidase A8 family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

Q: What is Bacillus clausii Lipoprotein signal peptidase (lspA) and what is its function?

A: Lipoprotein signal peptidase (lspA), also known as Signal peptidase II (SPase II), is a membrane-bound aspartyl protease that plays a critical role in bacterial lipoprotein processing. In Bacillus clausii, this enzyme consists of 151 amino acids and functions by cleaving the signal peptide from prolipoproteins after they have been modified by Lgt (prolipoprotein diacylglyceryl transferase) . This processing step is essential for proper localization and function of lipoproteins, which contribute to bacterial cell envelope integrity, nutrient acquisition, and virulence. LspA is considered an attractive antimicrobial target because it has no mammalian equivalents, and its active site is accessible to potential drugs at the outer surface of the inner membrane .

Q: How does the structure of B. clausii lspA compare to orthologs from other bacterial species?

A: While detailed structural information specific to B. clausii lspA is limited, structural insights can be inferred from better-characterized orthologs like those from Staphylococcus aureus (LspMrs) and Pseudomonas aeruginosa (LspPae). LspA typically consists of four transmembrane helices (H1-H4) with the catalytic dyad aspartates positioned toward the membrane's outer surface . There is also a β-cradle, a hemi-cylindrically shaped sheet that sits on the membrane and accommodates the substrate's C-terminal region.

Q: What are the optimal methods for recombinant expression of B. clausii lspA?

A: Recombinant B. clausii lspA is typically expressed in E. coli expression systems, similar to other bacterial lspA proteins . Based on successful approaches with related lspA proteins, the following methodology is recommended:

  • Gene optimization: The lspA gene sequence should be codon-optimized for E. coli expression to enhance protein yields.

  • Expression vector selection: Vectors like pET28a that provide N-terminal hexahistidine tags facilitate purification while potentially preserving enzyme activity.

  • Expression host: E. coli C43(DE3) strain has proven effective for membrane protein expression, including lspA orthologs .

  • Culture conditions: Growth in rich media (such as TB) supplemented with appropriate antibiotics at 37°C until reaching OD600 of 0.5-0.6, followed by induction with IPTG (typically 1 mM) at reduced temperature (30°C) for extended periods (18 hours) maximizes protein yield while minimizing inclusion body formation .

  • Detergent selection: Mild detergents like LMNG (lauryl maltose neopentyl glycol) have been successfully used for solubilization and purification of functional lspA proteins .

Q: What challenges exist in purifying active recombinant lspA and how can they be overcome?

A: Purifying active recombinant lspA presents several challenges due to its membrane-integrated nature. Key challenges and solutions include:

  • Membrane extraction: Efficient extraction requires careful selection of detergents that maintain enzyme structure and function. LMNG has proven effective for lspA orthologs .

  • Protein stability: Addition of glycerol (5-50%) to storage buffers enhances stability during freeze-thaw cycles. The recommended final concentration is 50% glycerol for long-term storage at -20°C/-80°C .

  • Maintaining catalytic activity: Inclusion of reducing agents like DTT (1 mM) in buffers helps maintain the native conformation of cysteine residues that may be important for activity .

  • Reconstitution protocols: For functional studies, reconstitution in appropriate lipid environments (such as DOPG - dioleoylphosphatidylglycerol) may be necessary to restore full enzymatic activity .

  • Storage considerations: Aliquoting the purified enzyme and avoiding repeated freeze-thaw cycles preserves activity. Working aliquots can be stored at 4°C for up to one week .

Q: What methods are available for assessing lspA enzymatic activity in research settings?

A: Several complementary approaches can be used to assess lspA activity:

  • Gel-shift assays: This coupled assay involves Lgt-mediated conversion of pre-prolipoprotein substrates to prolipoproteins, followed by lspA cleavage. The processing is monitored by SDS-PAGE where cleaved products show altered migration patterns. This approach has been established using pre-proICP (inhibitor of cysteine protease) as substrate .

  • FRET-based assays: Fluorescence resonance energy transfer peptides containing the lspA cleavage site allow real-time, quantitative monitoring of enzyme activity. This method enables determination of kinetic parameters such as Km and Vmax .

  • Inhibition studies: Both assay types can be adapted to measure IC50 values for inhibitors like globomycin and myxovirescin, with dose-response curves generated using inhibitor concentrations from 0 to 3.2 mM .

  • Lipoprotein processing in vivo: Expression of reporter lipoproteins in bacterial systems with wild-type or mutant lspA provides insights into processing efficiency in cellular contexts.

A typical gel-shift activity assay protocol includes:

  • Reaction mixture containing 12 μM pre-proICP, 250 μM DOPG, and 1.2 μM Lgt in buffer (50 mM Tris/HCl pH 7.5, 150 mM NaCl, 1 mM DTT, 0.02% LMNG)

  • Incubation at 37°C for 60 minutes to generate the lspA substrate

  • Addition of 0.5 μM lspA to initiate the reaction

  • Monitoring progress through timed sampling and SDS-PAGE analysis

Q: How do inhibitors like globomycin interact with lspA at the molecular level, and what implications does this have for drug design?

A: High-resolution crystal structures of lspA from pathogens like S. aureus in complex with inhibitors have provided valuable insights into inhibitor binding modes and mechanisms. Key findings include:

  • Inhibition mechanism: Globomycin, a cyclic depsipeptide, inhibits lspA by positioning its β-hydroxyl group between the catalytic aspartates (Asp118 and Asp136 in LspMrs), acting as a non-cleavable tetrahedral intermediate analog .

  • Binding site architecture: The inhibitor binds in a pocket formed by the transmembrane helices and the β-cradle region, with an extracellular loop sitting above the substrate binding pocket .

  • Structural convergence: Despite having different molecular structures, both globomycin and myxovirescin inhibit lspA similarly as tetrahedral intermediate analogs. Remarkably, these structurally distinct antibiotics superpose along nineteen contiguous atoms that interact similarly with lspA .

  • Blueprint for drug development: This 19-atom motif appears to recapitulate part of the substrate lipoprotein in its binding mode. This provides a valuable template for designing new inhibitors that incorporate this motif into scaffolds with improved pharmacokinetic properties .

  • Species-specific differences: Different bacterial species show varying sensitivities to inhibitors. For example, when using proICP as substrate, the IC50 of LspPae for globomycin was 0.64 μM at an enzyme concentration of 0.5 μM, while for LspMrs it was 171 μM at the same enzyme concentration .

These structural insights suggest that effective antimicrobials targeting lspA could be developed by preserving the key 19-atom interaction motif while modifying peripheral regions to optimize pharmacokinetic properties and overcome species-specific variations in sensitivity.

Q: How do site-directed mutations in lspA's catalytic regions affect enzyme function and inhibitor binding?

A: Site-directed mutagenesis studies of lspA catalytic residues provide critical insights into enzyme mechanism and inhibitor interactions:

  • Catalytic dyad mutations: Alterations to the conserved aspartate residues (Asp118 and Asp136 in LspMrs) typically result in complete loss of catalytic activity, confirming their essential role in the proteolytic mechanism .

  • Substrate binding pocket mutations: Modifications to residues lining the substrate binding pocket can differentially affect substrate processing versus inhibitor binding, potentially revealing opportunities for selective inhibitor design.

  • Transmembrane domain mutations: Changes to residues in transmembrane helices can alter global protein stability and folding, indirectly affecting catalytic efficiency.

  • β-cradle mutations: Alterations to this region, which accommodates substrate C-terminal residues, can provide insights into substrate specificity determinants across different bacterial species.

  • Extracellular loop modifications: Changes to the loop sitting above the substrate binding pocket may affect substrate access and product release without directly impacting catalysis.

Experimental approaches for such studies typically involve:

  • Generating site-directed mutants using PCR-based methods

  • Expression and purification using protocols established for wild-type enzyme

  • Comparative activity assessment using gel-shift and FRET-based assays

  • Structural analysis of mutant-inhibitor complexes where possible

  • Computational modeling to predict effects of mutations on protein dynamics

Q: What is the significance of lspA in bacterial virulence and host-pathogen interactions?

A: LspA plays critical roles in bacterial virulence and host-pathogen interactions, as evidenced by several studies:

  • Survival in human blood: LspA-deficient mutants of S. aureus demonstrate reduced ability to survive in whole human blood compared to wild-type strains. Importantly, this survival defect was restored by complementation with the lspA gene, confirming the enzyme's role in pathogenesis .

  • Phagocyte resistance: The reduced survival of lspA mutants in blood (but not in plasma) indicates that lspA activity contributes to resistance against phagocytic killing mechanisms rather than affecting growth in host environments .

  • Virulence attenuation: LspA-deficient mutants of methicillin-sensitive S. aureus showed attenuated virulence in mouse infection models, with disruption of lspA leading to reduced virulence in a bacteremia model .

  • Essential nature: While lspA is not essential for viability in Gram-positive bacteria like S. aureus (unlike in Gram-negative bacteria where it is essential), it significantly contributes to pathogenicity, making it an attractive target for anti-virulence therapies .

  • Barrier function: In beneficial bacteria like B. clausii, lspA's role in processing lipoproteins contributes to enhanced barrier function and gut homeostasis .

These findings collectively highlight lspA as a promising target for anti-virulence strategies, particularly for addressing multidrug-resistant pathogens like MRSA. Targeting virulence factors rather than essential functions may reduce selective pressure for resistance development.

Q: How does the membrane environment affect lspA function and inhibitor binding?

A: The membrane environment significantly influences lspA function and inhibitor interactions through multiple mechanisms:

  • Lipid composition effects: Different phospholipids can modulate enzyme activity by affecting membrane fluidity and charge distribution. For example, DOPG (dioleoylphosphatidylglycerol) is commonly used in assay systems to provide an appropriate lipid environment for lspA activity .

  • Substrate presentation: The membrane anchors proproteins in an orientation that facilitates access to the lspA active site, which is positioned toward the membrane's outer surface .

  • Inhibitor access: The accessibility of lspA's active site from the membrane's outer surface makes it amenable to inhibition by antibiotics like globomycin and myxovirescin, which approach the binding pocket from different directions .

  • Structural stability: The transmembrane helices of lspA interact with membrane lipids, stabilizing the enzyme's tertiary structure and maintaining proper positioning of the catalytic residues.

  • Species-specific interactions: Variations in membrane composition between different bacterial species may partially explain the observed differences in inhibitor sensitivity between lspA orthologs.

Experimental approaches to study these effects include:

  • Reconstitution in defined lipid systems with varying compositions

  • Molecular dynamics simulations of lspA-membrane interactions

  • Comparative analysis of inhibitor binding in different membrane environments

  • Site-directed spin labeling combined with electron paramagnetic resonance spectroscopy to probe conformational dynamics in membranes

Q: What strategies can overcome species-specific differences in lspA inhibitor sensitivity?

A: Addressing species-specific variations in lspA inhibitor sensitivity requires multifaceted approaches:

  • Structural comparison: Crystal structures of lspA from multiple pathogens (like the available structures from S. aureus and P. aeruginosa) enable identification of conserved binding elements versus species-specific differences .

  • Pharmacophore modeling: The identification of a common 19-atom motif in both globomycin and myxovirescin that interacts similarly with lspA provides a blueprint for designing broad-spectrum inhibitors .

  • Hybrid inhibitor design: Developing compounds that incorporate the conserved 19-atom interaction motif while possessing flexible peripheral groups that can accommodate species-specific binding pocket variations.

  • Targeted specificity: For some applications, species-specific inhibitors might be preferable to reduce impact on beneficial microbiota. This would involve exploiting unique structural features of lspA from target pathogens.

  • Combination approaches: Using lspA inhibitors alongside membrane-perturbing agents or other antibiotics targeting cell envelope processes could enhance efficacy against resistant strains.

  • Assay standardization: Developing standardized assay conditions that account for species-specific differences in optimal reaction conditions (as evidenced by the different kinetic parameters observed for LspMrs versus LspPae) .

These strategies can facilitate the development of both broad-spectrum antimicrobials for serious infections and narrower-spectrum agents for targeted therapy with reduced collateral effects on microbiome composition.

Q: How can computational methods enhance lspA-targeted drug discovery?

A: Computational approaches offer powerful tools for accelerating lspA-targeted drug discovery:

  • Molecular dynamics simulations: These can reveal dynamic conformational changes in lspA not captured in static crystal structures, potentially identifying transient binding pockets for inhibitor design.

  • Quantum mechanics/molecular mechanics (QM/MM) studies: These approaches can elucidate the detailed mechanism of catalysis and inhibition, focusing computational resources on the catalytic center while treating the rest of the protein with less expensive methods.

  • Virtual screening: Using the identified 19-atom pharmacophore as a template for screening virtual compound libraries to discover novel chemical scaffolds with potential inhibitory activity .

  • Machine learning approaches: Training models on known inhibitor data to predict properties of untested compounds and prioritize candidates for synthesis and testing.

  • Homology modeling: For species lacking experimental structures, high-quality models can be generated based on available crystal structures, enabling virtual screening for species-specific inhibitors.

  • Binding free energy calculations: Methods like MM-GBSA (Molecular Mechanics-Generalized Born Surface Area) can estimate binding affinities of proposed inhibitors, helping to prioritize compounds for experimental testing.

The computational approaches should be integrated with experimental validation, forming an iterative design-test-refine cycle to efficiently develop potent and selective lspA inhibitors.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.