Recombinant Bacillus clausii Protease prsW (prsW)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you require a specific format, please indicate your preference in the order notes. We will prepare the product according to your request.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributor for specific delivery times.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance. Additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers may use this as a reference.
Shelf Life
Shelf life is influenced by various factors such as storage conditions, buffer composition, temperature, and the protein's inherent stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is recommended for multiple use. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type requirement, please inform us, and we will prioritize the development of the specified tag.
Synonyms
prsW; ABC1865; Protease PrsW; Protease responsible for activating sigma-W
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-215
Protein Length
full length protein
Species
Bacillus clausii (strain KSM-K16)
Target Names
prsW
Target Protein Sequence
MVSLVLAALAPAMALFSYVYLRDVYSKAKMFLVLRIFIIGALLVVPILVIQFAFTEENVF PHPAAKAFLLYGFLEEGLKWLMLFVFAYQHGQLQRPGDGILFGVSVSLGFATVENGLYMI AYGLEAAIPRTVLPTTAHAVYGIVMGYYIGQAKYKEDHKKMFLLLGAILPILLHGGYDFI LSSFGHYVLYAMIPFMVILWLLAIWKLKKASRFTV
Uniprot No.

Target Background

Function
This protease plays a crucial role in the degradation of specific anti-sigma factors. It is responsible for the Site-1 cleavage of the RsiW anti-sigma factor, which, following two additional proteolytic steps catalyzed by the RasP and ClpXP proteases, results in the release of SigW and the transcriptional activation of genes regulated by the sigma-W factor.
Database Links

KEGG: bcl:ABC1865

STRING: 66692.ABC1865

Protein Families
Protease PrsW family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is Bacillus clausii Protease prsW and what is its biological function?

Bacillus clausii Protease prsW (prsW) is a membrane-embedded metalloprotease that plays a critical role in bacterial stress response mechanisms. The primary function of prsW is activating sigma-W (σW), an extracytoplasmic function (ECF) sigma factor that controls gene expression during various stress conditions . In Bacillus species, prsW is responsible for the initial cleavage of anti-sigma factors, which ultimately leads to the release and activation of sigma-W . This activation triggers the expression of genes that protect the bacterial cell against agents that impair cell wall biosynthesis and other environmental stresses .

The full-length Bacillus clausii Protease prsW protein consists of 215 amino acids with a molecular structure that includes transmembrane domains characteristic of membrane-embedded proteases . The protein is also known by alternative names such as "Protease responsible for activating sigma-W" and has the gene name prsW (synonym: ABC1865) .

How does Bacillus clausii Protease prsW differ from other bacterial proteases?

Bacillus clausii Protease prsW belongs to a specialized class of intramembrane proteases that differs from conventional proteases in several significant ways:

  • Membrane localization: Unlike many secreted bacterial proteases, prsW is embedded in the cell membrane and performs proteolysis within the membrane environment .

  • Substrate specificity: prsW shows high specificity for anti-sigma factors, particularly those involved in regulating sigma-W activity, rather than having broad proteolytic activity .

  • Activation mechanism: The protease functions as part of a regulated proteolysis cascade, where it performs the initial cleavage of the anti-sigma factor, which is then further processed by other proteases .

  • Functional conservation: While a novel 23,460 Da protease from B. clausii UBBC07 shows only 36% homology to the existing Din b family protein with strong metalloprotease-like properties, it demonstrates significant antimicrobial activity against diarrhea-causing pathogens such as Bacillus cereus and Salmonella enterica .

This specialized function distinguishes prsW from general proteases like subtilisin and other secreted proteases from Bacillus species that have broader substrate ranges and different biological roles .

What experimental approaches are most effective for studying prsW activity in different Bacillus clausii strains?

When investigating prsW activity across different Bacillus clausii strains, researchers should consider a multi-methodological approach:

  • Biochemical characterization: Purify the recombinant protein and assess its activity using specific substrates. The protein can be expressed in E. coli with appropriate tags (such as His-tag) for purification . After purification, measure proteolytic activity under various conditions (pH, temperature, salt concentration) to determine optimal reaction parameters.

  • Comparative genomics and proteomics: Analyze the prsW gene and protein sequences across different B. clausii strains (O/C, N/R, SIN, and T) to identify strain-specific variations that might correlate with functional differences .

  • Functional assays:

    • In vitro proteolysis assays: Using synthetic peptides or purified anti-sigma factors as substrates

    • Well-diffusion and gel-overlay assays: To confirm antimicrobial activity against relevant pathogens

    • Time-kill kinetics: To quantify bactericidal effects against target organisms like B. cereus and S. enterica

  • Microscopy analysis: Examine the effects of purified prsW on bacterial cell morphology using techniques like Gram-staining followed by compound microscopy to observe cell surface changes and membrane integrity .

  • Transcriptional profiling: Use techniques like run-off transcription followed by macroarray analysis (ROMA) to identify genes regulated by the sigma-W factor that is activated by prsW, providing insights into the downstream effects of prsW activity .

For optimal results, researchers should combine multiple approaches, as no single approach typically identifies more than 80% of the regulatory network components .

How do environmental conditions affect the expression and activity of prsW in Bacillus clausii?

The expression and activity of prsW in Bacillus clausii are influenced by various environmental factors:

For comprehensive characterization of environmental effects, researchers should employ controlled experimental conditions that systematically vary parameters such as pH, temperature, salt concentration, and exposure to intestinal components when measuring prsW expression and activity.

What is the relationship between prsW activity and antimicrobial properties of Bacillus clausii?

The relationship between prsW activity and antimicrobial properties of Bacillus clausii is complex and multifaceted:

  • Direct antimicrobial activity: Research on a novel protease from B. clausii UBBC07 (with metalloprotease-like properties similar to prsW) demonstrates direct inhibitory effects against diarrhea-causing pathogens. This protease exhibits a minimum inhibitory concentration (MIC) of 9.78 μM against both Bacillus cereus and Salmonella enterica .

  • Mechanism of pathogen inhibition: The antimicrobial action appears to operate through proteolytic degradation of essential cell surface components. Microscopic analysis of B. cereus and S. enterica treated with purified protease from B. clausii shows damaged cell membranes and debris formation around the cells, consistent with proteolytic activity targeting cell surface structures .

  • Time-dependent bactericidal effects: Time-kill kinetics studies reveal that the purified protease from B. clausii UBBC07 causes a sharp decline in viable bacterial counts (measured as log10 CFU/ml) within 4 hours of treatment, confirming potent bactericidal activity against both B. cereus and S. enterica, with p-values of <0.00009 and <0.00005, respectively .

  • Comparison with other B. clausii proteases: Other proteases from B. clausii have been documented to counteract bacterial toxins. For example, a serine protease from B. clausii O/C strain has been shown to neutralize toxins from Clostridium difficile and Bacillus cereus in cell line studies .

  • Regulatory role in probiotic function: The prsW-sigma-W regulatory pathway controls genes that protect bacterial cells against agents that impair cell wall biosynthesis . This protective function may contribute to B. clausii's survival in the competitive gut environment, indirectly supporting its probiotic and antimicrobial properties.

These findings suggest that prsW and related proteases contribute significantly to the antimicrobial capabilities of B. clausii, making them potential candidates for development as antimicrobial agents that could address issues of antibiotic resistance .

What are the optimal conditions for expressing and purifying recombinant Bacillus clausii Protease prsW?

Based on the available research data, the following protocol represents the optimal conditions for expression and purification of recombinant Bacillus clausii Protease prsW:

Expression System Selection:

  • E. coli is the preferred expression host for recombinant B. clausii Protease prsW production

  • Alternative systems include yeast, baculovirus, or mammalian cell expression systems for specialized applications

Construct Design:

  • Include an N-terminal His-tag to facilitate purification

  • Full-length protein (1-215 amino acids) should be used for most applications

  • For difficult expressions, partial constructs can be considered

Expression Conditions:

  • Induce protein expression under conditions optimized for membrane protein production

  • Control temperature, typically lowering to 16-25°C after induction to enhance proper folding

  • Monitor expression using SDS-PAGE analysis with expected band size around 23-24 kDa

Purification Protocol:

  • Harvest cells and lyse using appropriate buffer systems

  • Perform initial purification using nickel affinity chromatography to capture His-tagged protein

  • Further purify using size exclusion chromatography or ion exchange chromatography as needed

  • Verify purity using SDS-PAGE (aim for >90% purity)

Storage and Handling:

  • For lyophilized powder format:

    • Reconstitute in deionized sterile water to 0.1-1.0 mg/mL

    • Add glycerol to 5-50% final concentration (50% is recommended)

    • Aliquot and store at -20°C/-80°C for long-term storage

  • For liquid format:

    • Store in glycerol-containing buffer at -20°C

    • Avoid repeated freeze-thaw cycles

    • Keep working aliquots at 4°C for up to one week

These protocols should yield recombinant Bacillus clausii Protease prsW with purity greater than 90% as determined by SDS-PAGE, suitable for downstream applications in research .

What methods are most effective for assessing prsW proteolytic activity in vitro?

Several complementary methods can be employed to comprehensively evaluate prsW proteolytic activity in vitro:

1. Synthetic Substrate Assays:

  • Use fluorogenic or chromogenic peptide substrates containing specific cleavage sites

  • Measure activity through spectrophotometric or fluorometric detection of released products

  • This approach allows for high-throughput screening and kinetic analysis of protease activity

2. Well-Diffusion Assays:

  • Prepare agar plates seeded with target bacteria (e.g., B. cereus or S. enterica)

  • Create wells and add purified prsW at various concentrations

  • Measure zones of inhibition after appropriate incubation

  • This method effectively demonstrates antimicrobial activity against diarrhea-causing pathogens

3. Gel-Overlay Assays:

  • Separate proteins by SDS-PAGE

  • Overlay gels with substrates or target bacteria

  • Identify zones of clearance corresponding to proteolytic activity

  • This technique confirms the molecular weight of active protease (~23.4 kDa for novel B. clausii protease)

4. Time-Kill Kinetics:

  • Expose bacterial suspensions to purified prsW

  • Sample at defined time intervals (e.g., 0, 2, 4, 6, 8 hours)

  • Quantify viable cells by plating and counting colonies

  • Plot log10(CFU/ml) vs. time to determine bactericidal efficacy

  • A sharp decline in CFU within 4 hours indicates potent bactericidal activity

5. Microscopic Analysis:

  • Treat bacterial cells with purified prsW

  • Perform Gram staining and observe using compound microscopy

  • Examine cell membrane integrity and morphological changes

  • Look for evidence of cell damage and debris formation around cells

6. Physicochemical Stability Testing:

  • Assess activity across a range of pH values and temperatures

  • Measure retention of proteolytic activity under extreme conditions

  • Calculate percentage of activity retained compared to optimal conditions

  • The novel B. clausii protease retains up to 50% activity at extreme pH and high temperatures

For determining minimum inhibitory concentration (MIC), serial dilutions of purified prsW should be tested against target pathogens. The MIC for B. clausii UBBC07 protease against B. cereus and S. enterica was determined to be 9.78 μM .

How can researchers effectively characterize the substrate specificity of Bacillus clausii prsW?

Characterizing the substrate specificity of Bacillus clausii prsW requires a methodical approach combining several complementary techniques:

1. Peptide Library Screening:

  • Use combinatorial peptide libraries to identify preferential cleavage motifs

  • Analyze cleavage products using mass spectrometry or HPLC

  • Map the preferential amino acid residues at positions P4-P4' surrounding the cleavage site

  • This approach provides a comprehensive profile of sequence preferences

2. Natural Substrate Identification:

  • Test purified anti-sigma factors (particularly those associated with sigma-W)

  • Analyze cleavage patterns using SDS-PAGE and Western blotting

  • Confirm cleavage sites by N-terminal sequencing or mass spectrometry

  • This method validates biological relevance of identified substrates

3. Comparative Analysis with Known Intramembrane Proteases:

  • Compare activity against substrates of related proteases from the Din b family

  • Analyze cleavage pattern similarities and differences

  • This approach contextualizes prsW within existing protease classifications

4. Site-Directed Mutagenesis Studies:

  • Systematically mutate key residues in the active site

  • Measure effects on catalytic activity against different substrates

  • Identify residues critical for substrate recognition versus catalysis

  • This technique pinpoints the molecular determinants of specificity

5. Inhibitor Profiling:

  • Test sensitivity to different protease inhibitors (serine, cysteine, metalloproteases)

  • Determine IC50 values for each inhibitor class

  • The strong metalloprotease-like properties observed in related B. clausii proteases suggest metalloprotease inhibitors may be most effective

6. Structural Biology Approaches:

  • Develop structural models of prsW based on homologous proteins

  • Use computational docking to predict substrate binding modes

  • Validate predictions experimentally

  • This provides mechanistic insights into substrate recognition

7. In Vitro Transcription-Translation Systems:

  • Reconstitute the sigma-W regulatory pathway components in vitro

  • Measure prsW-dependent activation of sigma-W

  • This approach demonstrates functional relevance of substrate cleavage

When characterizing novel B. clausii proteases, researchers should note that significant sequence divergence may exist, as evidenced by the novel protease from B. clausii UBBC07 showing only 36% homology to known Din b family proteins while maintaining strong metalloprotease-like properties .

How can recombinant Bacillus clausii Protease prsW be utilized in studies of bacterial stress response?

Recombinant Bacillus clausii Protease prsW offers several valuable applications in bacterial stress response research:

1. Sigma Factor Activation Studies:

  • Use purified prsW to investigate the regulated proteolysis cascade that activates sigma-W

  • Monitor sigma-W-dependent gene expression following treatment with recombinant prsW

  • Employ techniques like run-off transcription followed by macroarray analysis (ROMA) to identify genes in the sigma-W regulon

  • This approach reveals how prsW-mediated proteolysis triggers adaptive responses to environmental stresses

2. Cell Envelope Stress Models:

  • Apply recombinant prsW in combination with cell wall-targeting antibiotics

  • Monitor changes in gene expression, particularly those involved in cell wall biosynthesis

  • This method helps elucidate how bacteria respond to and recover from cell envelope damage

3. Comparative Strain Analysis:

  • Use recombinant prsW to study differences in stress response mechanisms across various B. clausii strains (O/C, N/R, SIN, and T)

  • Compare proteolytic processing of anti-sigma factors from different strains

  • This approach reveals strain-specific adaptations to environmental challenges

4. Reconstitution of Regulatory Pathways:

  • Establish in vitro systems that reconstitute the complete regulatory pathway

  • Include anti-sigma factors, prsW, secondary proteases, and sigma-W

  • Monitor the sequential processing events that lead to sigma-W activation

  • This system allows precise manipulation of pathway components to understand regulatory dynamics

5. Cross-Species Regulatory Studies:

  • Compare prsW function between B. clausii and related organisms like B. subtilis

  • Investigate whether B. clausii prsW can complement prsW mutations in other species

  • This approach reveals evolutionary conservation and divergence in stress response mechanisms

6. Stress Response Kinetics:

  • Use time-course experiments with recombinant prsW to determine the temporal dynamics of stress response

  • Measure the speed of sigma-W activation following prsW treatment

  • This reveals how quickly bacteria can mount adaptive responses to environmental challenges

These applications collectively provide a comprehensive understanding of how prsW contributes to bacterial stress response mechanisms, potentially revealing new targets for antimicrobial development or strategies for enhancing probiotic properties of B. clausii strains.

What is the potential of Bacillus clausii prsW as a therapeutic agent against pathogenic bacteria?

The therapeutic potential of Bacillus clausii prsW as an antimicrobial agent is supported by several promising research findings:

1. Direct Antimicrobial Activity:

  • Research on a novel protease from B. clausii UBBC07 with metalloprotease-like properties demonstrates potent activity against diarrhea-causing pathogens

  • The minimum inhibitory concentration (MIC) against both Bacillus cereus and Salmonella enterica was determined to be 9.78 μM

  • Time-kill kinetics showed a significant reduction in viable bacterial counts within 4 hours of treatment, with p-values of <0.00009 and <0.00005 for B. cereus and S. enterica, respectively

2. Mechanism of Action:

  • Microscopic analysis reveals that treatment with B. clausii proteases causes visible damage to bacterial cell membranes

  • Formation of debris around treated cells indicates proteolytic degradation of cell surface components

  • This mechanism differs from conventional antibiotics, potentially addressing antibiotic resistance issues

3. Stability Advantages:

  • B. clausii proteases demonstrate remarkable stability across broad temperature and pH ranges

  • They retain up to 50% activity at extreme temperatures and pH conditions

  • This stability enhances potential for formulation into effective therapeutic products

4. Comparative Advantages Over Conventional Therapies:

  • Proteases from B. clausii may provide alternatives to antibiotics, reducing the risk of antibiotic resistance development

  • The specificity for certain pathogens may allow targeted treatment with minimal impact on beneficial microbiota

5. Potential Therapeutic Applications:

  • Treatment of gastrointestinal infections caused by pathogens like B. cereus and S. enterica

  • Combination therapy with probiotics to enhance gut health

  • Topical applications for surface contamination control

6. Development Considerations:

  • Protein engineering could enhance specificity and activity

  • Formulation challenges for oral delivery must address gastric degradation

  • Safety profiles must be established through appropriate testing

7. Future Research Directions:

  • Structure-activity relationship studies to identify essential domains

  • In vivo efficacy testing in animal models of infection

  • Screening against broader pathogen panels to determine spectrum of activity

While initial findings are promising, researchers should note that therapeutic development would require extensive additional testing, including:

  • In vivo efficacy in appropriate animal models

  • Safety and toxicity assessments

  • Formulation development for clinical applications

  • Evaluation of potential resistance mechanisms

The extracellularly released proteins/proteases from B. clausii could potentially serve as strong tools in treating diarrheal infections and other bacterial diseases, offering cost-effective alternatives to conventional antibiotics .

How does prsW contribute to the probiotic properties of Bacillus clausii?

The contribution of prsW to Bacillus clausii's probiotic properties involves several interconnected mechanisms:

1. Antimicrobial Activity Against Pathogens:

  • B. clausii proteases, including prsW-like enzymes, demonstrate direct inhibitory effects against diarrhea-causing pathogens such as Bacillus cereus and Salmonella enterica

  • Time-kill kinetics studies show significant bactericidal activity within 4 hours of treatment

  • This antimicrobial activity helps create a favorable gut environment by suppressing pathogenic bacteria

2. Protection Against Bacterial Toxins:

  • Proteases from B. clausii O/C strain have been shown to counteract toxins produced by Clostridium difficile and Bacillus cereus in cell line studies

  • This detoxification mechanism may protect intestinal cells from damage during infections

3. Enhancement of Gut Barrier Function:

  • B. clausii strains have been shown to protect the gut from viral infections through multiple mechanisms:

    • Induction of antimicrobial peptides (human beta defensin 2 and cathelicidin)

    • Rescue of cell proliferation slowed by infections

    • Reduction of necrotic or apoptotic enterocytes

    • Increased mucin production

    • Enhanced synthesis of tight junction proteins

  • While these effects are attributed to B. clausii strains generally, the regulatory pathways potentially involving prsW may contribute to these protective mechanisms

4. Immunomodulatory Effects:

  • B. clausii strains demonstrate immunomodulatory properties in various experimental models:

    • Induction of nitric oxide production in RAW 264.7 murine macrophage cell line

    • Increased expression of pro-inflammatory cytokines and stimulation of nitrite production

    • Proliferation of CD4+ T cells

  • These effects suggest that B. clausii influences host immune responses, potentially through regulatory pathways involving prsW

5. Adaptability to Intestinal Environment:

  • B. clausii can tolerate bile salts and pH 2 environment, and successfully germinate in the intestinal environment

  • The prsW-sigma-W regulatory pathway may contribute to this environmental adaptability by controlling genes involved in stress response

6. Gene Expression Reprogramming in Host Cells:

  • Vegetative cells of B. clausii affect global reprogramming of gene expression in gastrointestinal tract cells

  • In duodenal cells, B. clausii influences the expression of genes involved in:

    • Immunity and inflammation

    • Apoptosis

    • Cell growth and differentiation

    • Cell-cell signaling

    • Cell adhesion

    • Signal transcription and transduction

  • These changes in host gene expression may be partially mediated by signaling pathways influenced by prsW activity

These diverse mechanisms collectively contribute to the probiotic efficacy of B. clausii, with prsW potentially playing both direct roles (through its proteolytic activity) and indirect roles (through its regulatory functions in bacterial physiology).

What are the most promising areas for future research on Bacillus clausii Protease prsW?

Based on current knowledge and research gaps, several high-priority areas for future investigation of Bacillus clausii Protease prsW emerge:

1. Structural Characterization:

  • Determine the three-dimensional structure of prsW using X-ray crystallography or cryo-electron microscopy

  • Map the active site architecture and substrate binding pockets

  • Compare structural features with other intramembrane proteases

  • This fundamental knowledge would enable structure-based design of inhibitors or enhanced variants

2. Detailed Mechanistic Studies:

  • Elucidate the precise catalytic mechanism of proteolysis

  • Identify the metal cofactor requirements and coordination geometry

  • Determine rate-limiting steps in the catalytic cycle

  • This information would clarify how prsW functions at the molecular level

3. Comprehensive Substrate Profiling:

  • Identify the complete repertoire of natural substrates beyond anti-sigma factors

  • Determine whether prsW has broader substrate specificity than currently recognized

  • Map precise cleavage sites using modern proteomics approaches

  • This research would reveal the full biological impact of prsW activity

4. Strain-Specific Variations:

  • Compare prsW sequence, expression, and activity across different B. clausii strains (O/C, N/R, SIN, and T)

  • Correlate variations with strain-specific probiotic properties

  • This approach could identify optimal strain selection for specific therapeutic applications

5. Therapeutic Application Development:

  • Engineer enhanced prsW variants with improved stability or activity

  • Develop formulation strategies for oral delivery

  • Conduct preclinical efficacy studies in appropriate disease models

  • This translational research could lead to novel antimicrobial therapeutics

6. Resistance Mechanism Investigations:

  • Study whether pathogens can develop resistance to prsW-mediated killing

  • Identify potential resistance mechanisms

  • Compare with resistance development against conventional antibiotics

  • This research would inform long-term therapeutic utility

7. Host-Microbe Interaction Studies:

  • Investigate how prsW activity influences host cell responses

  • Determine effects on gut microbiome composition

  • Examine immunomodulatory consequences of prsW treatment

  • This work would clarify broader biological impacts beyond direct antimicrobial effects

8. Comparative Analysis with Related Proteases:

  • Compare B. clausii prsW with homologous proteases from other bacterial species

  • Identify conserved and divergent features

  • This approach would place prsW in an evolutionary context

9. Synergistic Combinations:

  • Evaluate combinations of prsW with other antimicrobial agents or probiotics

  • Identify synergistic interactions that enhance therapeutic efficacy

  • This strategy could lead to more effective treatment approaches

These research directions would collectively advance understanding of B. clausii prsW from basic biochemistry to applied therapeutics, potentially yielding novel approaches to combat antibiotic-resistant infections.

What technological advances could enhance research on prsW and its applications?

Several emerging technologies and methodological innovations could significantly advance research on Bacillus clausii Protease prsW:

1. Advanced Structural Biology Techniques:

  • Cryo-electron microscopy (Cryo-EM): Enables visualization of membrane proteins in near-native environments without crystallization

  • Hydrogen-deuterium exchange mass spectrometry (HDX-MS): Provides insights into protein dynamics and conformational changes during substrate binding

  • Integrative structural biology: Combines multiple techniques (X-ray, NMR, Cryo-EM, computational modeling) for comprehensive structural characterization

  • These approaches would overcome traditional challenges in membrane protein structural determination

2. Protein Engineering Platforms:

  • Directed evolution: Generates improved prsW variants through iterative rounds of mutagenesis and selection

  • Computational design: Uses algorithms to predict mutations that enhance stability, activity, or specificity

  • High-throughput screening: Enables rapid evaluation of thousands of variants

  • These methods could create optimized prsW variants for research or therapeutic applications

3. Advanced Omics Technologies:

  • Proteomics: Identifies the complete set of prsW substrates in vivo

  • Transcriptomics: Reveals global changes in gene expression triggered by prsW activity

  • Metaproteomics: Examines impacts on complex microbial communities

  • These approaches provide comprehensive views of prsW's biological impacts

4. Microfluidic and Organ-on-Chip Systems:

  • Gut-on-chip models: Recreate intestinal environment for studying prsW activity in physiologically relevant conditions

  • Droplet microfluidics: Enable single-cell analysis of bacterial responses to prsW

  • Continuous culture systems: Allow long-term studies of microbial adaptation to prsW

  • These technologies bridge the gap between in vitro assays and in vivo models

5. Advanced Imaging Techniques:

  • Super-resolution microscopy: Visualizes subcellular localization and dynamics of prsW

  • Live-cell imaging: Monitors real-time effects of prsW on bacterial cells

  • Correlative light and electron microscopy (CLEM): Combines functional and structural information

  • These methods provide spatial and temporal insights into prsW function

6. Synthetic Biology Approaches:

  • Reconstituted membrane systems: Control the lipid environment for studying prsW activity

  • Cell-free expression systems: Produce membrane proteins in controlled environments

  • Minimal cell systems: Study prsW in simplified cellular contexts

  • These platforms enable precise manipulation of components and conditions

7. Delivery Technologies for Therapeutic Applications:

  • Nanoparticle formulations: Protect protease activity during oral delivery

  • Targeted delivery systems: Direct prsW to specific intestinal regions

  • Controlled release formulations: Optimize therapeutic dosing

  • These approaches could enhance clinical translation of prsW-based therapeutics

8. In Silico Methods:

  • Molecular dynamics simulations: Model prsW interactions with membranes and substrates

  • Quantum mechanics/molecular mechanics (QM/MM): Investigate catalytic mechanisms

  • Systems biology modeling: Predict effects of prsW activity on cellular networks

  • These computational approaches complement experimental studies and generate testable hypotheses

Integration of these technological advances would accelerate understanding of prsW biology and development of applications, potentially leading to novel antimicrobial strategies against increasingly drug-resistant pathogens.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.