Recombinant Bacillus clausii Protein CrcB homolog 1 (crcB1)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please consult your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and can be used as a reference.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type will be determined during the production process. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
crcB1; ABC0864; Putative fluoride ion transporter CrcB 1
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-127
Protein Length
full length protein
Species
Bacillus clausii (strain KSM-K16)
Target Names
crcB1
Target Protein Sequence
MKLVYTYVAVALGGALGGAFRFILTIIFPFHNWPWGIFTANLGGCFLLGFLTPILQLKKS IPLAVKKGITVGLIGGFTTMSTFAADTIAMLQNGHLLGGSVYLLATVTGGMGFVALGFVL GARGRTR
Uniprot No.

Target Background

Function

Important Function: Reduces intracellular fluoride concentration, thereby mitigating its toxicity.

Database Links

KEGG: bcl:ABC0864

STRING: 66692.ABC0864

Protein Families
CrcB (TC 9.B.71) family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is CrcB homolog 1 and what is its function in Bacillus clausii?

CrcB homolog proteins are generally involved in fluoride ion channel activity and resistance to fluoride toxicity in prokaryotes. In Bacillus clausii, the CrcB homolog 1 likely functions as a transmembrane protein involved in ion transport, specifically fluoride export. Similar to other bacterial CrcB proteins, it likely contains multiple transmembrane domains with specific amino acid sequences that allow for selective ion transport across the cell membrane . Structurally, CrcB homologs typically form dimers that create an hourglass-shaped channel with a selectivity filter that allows the passage of fluoride ions while excluding other ions.

How does the protein structure of CrcB homolog 1 compare between Bacillus clausii and other bacterial species?

Based on comparative analysis with other bacterial species, CrcB homolog proteins typically consist of 100-120 amino acids that form multiple transmembrane helices. The CrcB homolog from Prochlorococcus marinus consists of 109 amino acids with multiple hydrophobic regions consistent with transmembrane domains . While the exact sequence of Bacillus clausii CrcB homolog 1 is not directly specified in the available data, it likely shares conserved structural features including:

  • Multiple transmembrane helices (typically 3-4)

  • Conserved arginine residues in the pore region

  • Dimerization interfaces for functional channel formation

  • Hydrophobic amino acid sequences within transmembrane domains

Sequence identity between bacterial CrcB homologs typically ranges from 30-60%, with higher conservation in the pore-forming regions.

What expression systems are most effective for producing recombinant Bacillus clausii CrcB homolog 1?

For expressing membrane proteins like CrcB homolog 1, E. coli-based expression systems have been shown to be effective, as demonstrated with the Prochlorococcus marinus CrcB homolog . The recommended expression system includes:

Expression System ComponentRecommended OptionRationale
Host strainE. coli BL21(DE3)Effective for membrane protein expression with minimal proteolysis
Expression vectorpET series (pET28a)Enables N-terminal His-tagging for purification
Induction methodIPTG (0.5-1.0 mM)Controllable induction of protein expression
Growth temperature18-25°C post-inductionReduces inclusion body formation for membrane proteins
Media supplements1% glucose, 1 mM betaineEnhances proper folding of membrane proteins

Growth in minimal media with controlled induction parameters is critical for obtaining correctly folded membrane proteins like CrcB homolog 1 .

How does Bacillus clausii CrcB homolog 1 contribute to antimicrobial properties when expressed as a recombinant protein?

Bacillus clausii is known to produce antimicrobial substances, including lantibiotics like clausin that show activity against gram-positive bacteria . While direct evidence for CrcB homolog 1's contribution to antimicrobial properties is limited, research suggests potential mechanisms:

  • Ion homeostasis disruption: CrcB-mediated changes in bacterial ion balance may synergize with other antimicrobial compounds produced by B. clausii.

  • Membrane integrity: As a transmembrane protein, recombinant CrcB may affect membrane permeability when introduced to target bacteria.

  • Regulatory effects: CrcB homologs may influence expression of antimicrobial compounds through signaling pathways.

In experimental models, B. clausii antimicrobial activity has been shown to inhibit pathogens like C. difficile and S. aureus . Testing recombinant CrcB homolog 1 against these pathogens in controlled experiments could elucidate its specific contribution to this antimicrobial activity.

What methodologies are most effective for studying the interaction between CrcB homolog 1 and host intestinal barrier function?

Studies on intestinal barrier function have demonstrated that bacterial proteins can influence barrier integrity, as seen with CRB1 protein effects on intestinal permeability . For studying CrcB homolog 1 interactions with intestinal barriers, several methodologies are recommended:

MethodologyApplicationMeasurable Outcomes
Transepithelial Electrical Resistance (TEER)Measures barrier integrity in intestinal cell monolayersQuantitative measurement of barrier function after exposure to recombinant CrcB
Fluorescein Isothiocyanate (FITC)-dextran permeability assayAssesses macromolecule passage across epithelial barriersPermeability changes induced by CrcB treatment
Immunofluorescence microscopyVisualizes tight junction proteinsLocalization changes in ZO-1, occludin, and claudins
RNA-seq analysisTranscriptome analysis of intestinal cellsGene expression changes in barrier function genes
In vivo mouse modelsTranslational assessment of barrier functionBacterial translocation, serum endotoxin levels

When designing these experiments, it is critical to use both wild-type and mutant versions of the recombinant protein to establish structure-function relationships .

How can researchers differentiate the effects of CrcB homolog 1 from other probiotic mechanisms in Bacillus clausii?

Differentiating the specific effects of CrcB homolog 1 from other probiotic mechanisms requires systematic experimental approaches:

  • Generate B. clausii strains with CrcB homolog 1 gene knockouts using CRISPR/Cas9 technology, similar to approaches used in CREB1 studies .

  • Complement these knockouts with plasmids expressing either wild-type or mutated CrcB homolog 1.

  • Compare probiotic effects through:

    • In vitro antimicrobial activity assays against indicator strains

    • Competitive adhesion assays with intestinal epithelial cells

    • Immunomodulatory effects on macrophage and dendritic cell cultures

    • Measurement of barrier function parameters

  • Use transcriptomic analysis to identify genes differentially regulated in the presence/absence of CrcB homolog 1, similar to the RRHO analysis approach used in CREB1 studies .

To isolate CrcB effects, researchers should control for other known mechanisms of B. clausii, including production of antimicrobial substances like clausin and M-protease .

What purification protocol yields the highest purity and activity for recombinant CrcB homolog 1?

Purification of membrane proteins like CrcB homolog 1 requires specialized approaches. Based on protocols used for similar membrane proteins and the Prochlorococcus marinus CrcB homolog , the following optimized protocol is recommended:

  • Cell lysis: Mechanical disruption with French press (20,000 psi) in buffer containing 50 mM Tris-HCl pH 8.0, 300 mM NaCl, 10% glycerol, 1 mM PMSF, and protease inhibitor cocktail.

  • Membrane solubilization: Solubilize membrane fraction with 1% n-dodecyl-β-D-maltoside (DDM) or 1% digitonin for 2 hours at 4°C.

  • Affinity chromatography: Apply solubilized protein to Ni-NTA resin, wash with 20-40 mM imidazole, and elute with 250-300 mM imidazole.

  • Size exclusion chromatography: Further purify using Superdex 200 column in buffer containing 0.05% DDM or digitonin.

  • Quality control: Assess purity by SDS-PAGE (expect >90% purity) and protein functionality through fluoride binding assays.

The typical yield from 1L of bacterial culture is approximately 1-3 mg of purified protein. Reconstitution into liposomes may be necessary for functional studies of this membrane protein .

How can researchers accurately measure the ion channel activity of recombinant CrcB homolog 1?

For membrane proteins with potential ion channel functionality like CrcB homolog 1, several specialized techniques can be employed:

TechniqueMeasurementAdvantagesLimitations
Planar lipid bilayer electrophysiologyDirect measurement of ion currentsSingle-channel resolutionTechnical complexity
Fluoride-selective electrode assaysIon flux in proteoliposomesSpecific for fluoride transportLower resolution
Fluorescent probe assays (MQAE)Halide-sensitive fluorescence quenchingReal-time measurementsIndirect measurement
Isothermal titration calorimetryBinding affinity for ionsThermodynamic parametersNo kinetic information
Radiolabeled ion flux assaysTransport rates using ^18F or other isotopesQuantitative transport dataRadiation safety concerns

When interpreting data, it's important to consider channel selectivity by testing multiple ions (F^-, Cl^-, Br^-) and using specific inhibitors to confirm channel identity. Control experiments with denatured protein or mutated versions lacking key functional residues are essential for validating channel-specific activity .

What are the common challenges in expressing functional CrcB homolog 1 and how can they be addressed?

Membrane protein expression faces several common challenges:

  • Low expression levels

    • Solution: Optimize codon usage for E. coli and use specialized vectors with strong but controllable promoters

    • Test multiple E. coli strains (C41, C43, Lemo21) specifically designed for membrane protein expression

  • Protein misfolding and aggregation

    • Solution: Lower induction temperature (16-18°C) and IPTG concentration (0.1-0.3 mM)

    • Add chemical chaperones (glycerol, trehalose) to expression media

  • Toxicity to host cells

    • Solution: Use tightly controlled expression systems (pBAD) with glucose repression

    • Consider cell-free expression systems for highly toxic proteins

  • Poor solubilization

    • Solution: Screen multiple detergents (DDM, LMNG, GDN) at various concentrations

    • Test detergent mixtures and lipid additives to enhance stability

  • Loss of function during purification

    • Solution: Include lipids during purification (0.1 mg/ml E. coli lipid extract)

    • Minimize exposure to detergents by using rapid purification protocols

Incorporating 6% trehalose in storage buffers, as used with Prochlorococcus marinus CrcB, can significantly enhance stability during storage .

How can researchers distinguish between the effects of CrcB homolog 1 and other proteins in experimental systems?

To isolate the specific effects of CrcB homolog 1:

  • Generate multiple control proteins:

    • Inactive mutants (point mutations in conserved residues)

    • Paralogs from the same organism (CrcB homolog 2)

    • Homologs from non-probiotic bacteria

  • Develop complementary approaches:

    • Antibody neutralization of the protein

    • Competitive inhibition with peptide fragments

    • RNA silencing of the gene in the native organism

  • Create reporter systems:

    • Fluoride-responsive promoters linked to reporter genes

    • FRET-based sensors for protein-protein interactions

    • Split-GFP complementation assays for protein localization

  • Design unbiased screening approaches:

    • Transcriptomic analysis comparing wild-type and CrcB-deficient strains

    • Metabolomic profiling to identify downstream effects

    • Proteomic analysis to identify interaction partners

This multi-faceted approach, similar to the strategy used in CREB1 studies , allows researchers to triangulate the specific effects attributable to CrcB homolog 1 versus other bacterial factors.

How might CrcB homolog 1 from Bacillus clausii contribute to microbiome-based therapeutic approaches?

The potential therapeutic applications of CrcB homolog 1 in microbiome-based interventions could include:

  • Enhanced probiotic colonization:

    • Engineering improved B. clausii strains with optimized CrcB homolog 1 expression

    • Using recombinant CrcB to enhance survival of beneficial bacteria in hostile gut environments

  • Targeted pathogen inhibition:

    • Developing CrcB-based antimicrobial peptides targeting specific pathogens

    • Creating localized ion gradient disruption in pathogen-rich environments

  • Barrier function modulation:

    • Similar to how CRB1 affects intestinal permeability , CrcB homolog 1 might be used to strengthen epithelial barriers

    • Recombinant CrcB could potentially reduce bacterial translocation in conditions with compromised gut barriers

  • Immunomodulatory applications:

    • Like other B. clausii components, CrcB may have immunomodulatory effects that could be harnessed therapeutically

    • Targeted delivery of CrcB to specific gut regions to modulate local immune responses

Research models should include both in vitro systems with intestinal organoids and in vivo approaches using gnotobiotic animals to assess these potential applications while ensuring mechanistic understanding of CrcB function.

What bioinformatic approaches are most useful for identifying novel functions of CrcB homolog proteins across bacterial species?

Advanced bioinformatic approaches for characterizing CrcB homologs include:

ApproachApplicationExpected Insights
Phylogenetic analysisEvolutionary relationships among CrcB proteinsIdentification of functional clades and species-specific adaptations
Structural prediction (AlphaFold2)3D structure modelingChannel architecture and ion selectivity determinants
Protein-protein interaction networksInteractome analysisFunctional associations and regulatory relationships
Genome neighborhood analysisGene context examinationCo-expressed genes and functional operons
Metagenomics miningEnvironmental distributionEcological niches and potential novel functions

Combining these approaches with experimental validation can reveal unexpected functions beyond the canonical fluoride transport role. For example, systematic mutation of conserved residues followed by functional characterization, similar to approaches used in CREB1 studies , can define structure-function relationships across CrcB homologs.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.