Recombinant Bacillus clausii UPF0059 membrane protein ABC3868 (ABC3868)

What is the UPF0059 membrane protein ABC3868 from Bacillus clausii?

The ABC3868 protein is a membrane protein belonging to the UPF0059 protein family found in Bacillus clausii. It is a full-length protein comprising 180 amino acids and functions as an integral membrane protein. The complete amino acid sequence is: MHEFVTICIMAAALGMDAFSVALGMGMLKLSGKQIFRIGLTIGHFHVAMPLAGMAVGKWLSGHFDVIATYIGGGLLLVIGVQMALNAFSDHEAEGLKPAGWGLLLFAVGVSLDSFSAGLSFGILGTEMFVTVGMIGAMSMVMSWIGLVGSHFQKFLGAYGELGGGLVLIGFGLKIMLPL . This protein is encoded by the ABC3868 gene in the Bacillus clausii genome, specifically identified in the KSM-K16 strain with UniProt accession number Q5WB61 .

What are the key properties of Bacillus clausii as a host organism?

Bacillus clausii is a Gram-positive probiotic bacterium with several advantageous physiological properties. These include heat, acid, and bile salt tolerance; enhancement of gut barrier function; broad spectrum antibiotic resistance that cannot be genetically transferred to other species; and vitamin synthesis capabilities . Various strains of B. clausii have been characterized, including O/C, N/R, SIN, T, B106, UBBC07, and KSM-K16 strains, with the latter being used in industrial applications . These properties make B. clausii an important microorganism for both probiotic applications and as a potential protein expression system.

How does one store and handle recombinant ABC3868 protein for optimal stability?

For optimal stability, recombinant ABC3868 protein should be stored at -20°C, and for extended storage, it should be conserved at either -20°C or -80°C . The protein is typically supplied in a Tris-based buffer with 50% glycerol, which has been optimized for this specific protein . It is important to note that repeated freezing and thawing is not recommended as this can lead to protein degradation and loss of activity. For short-term use, working aliquots can be stored at 4°C for up to one week . This storage methodology helps maintain protein integrity and functional properties for experimental applications.

What expression systems are most effective for producing recombinant membrane proteins like ABC3868?

For producing membrane proteins like ABC3868, Gram-positive bacterial expression systems have emerged as superior alternatives to E. coli systems, particularly when LPS-free preparations are required. Gram-positive bacteria offer advantages due to their LPS-free cell wall structure and well-defined SecB-dependent secretion pathway . Recent developments include specialized expression systems such as the pKS81 plasmid featuring the uhpT (glucose-6-phosphate transporter) promoter for high inducible expression of recombinant proteins. This system employs:

• The hexose phosphate transport regulatory system (HptARS) that responds to extracellular G6P

• An N-terminal SecB-dependent signal peptide sequence for protein secretion

• A C-terminal 8× histidine tag for purification by nickel affinity chromatography

Using such systems, researchers have achieved yields of up to 900 mg/L for various recombinant proteins . For membrane proteins specifically, optimization of the secretion signal, inducer concentration, and harvest timing are critical factors to consider.

How can researchers effectively purify recombinant ABC3868 while maintaining its native conformation?

Purifying membrane proteins like ABC3868 while preserving their native conformation requires specialized techniques. A methodological approach includes:

• Membrane extraction: Utilize gentle detergents (such as DDM, LDAO, or OG) to solubilize the membrane protein without denaturing it. Begin with a concentration series experiment to identify the optimal detergent and concentration.

• Affinity purification: Leverage the recombinant protein's histidine tag for nickel affinity chromatography. When using commercially available ABC3868, note that "the tag type will be determined during production process" , so verification of the tag is necessary before proceeding.

• Buffer optimization: Maintain a Tris-based buffer with glycerol (as used in the storage conditions) during purification to stabilize the protein structure . Consider adding specific lipids that may be required for maintaining the protein's native conformation.

• Confirmation of native folding: Use circular dichroism spectroscopy to verify secondary structure integrity, and consider thermal stability assays to assess protein quality after purification.

This methodical approach ensures that the recombinant ABC3868 retains its structural and functional properties during the purification process, which is crucial for subsequent functional studies.

What are the potential functional roles of ABC3868 in Bacillus clausii physiology?

While the specific function of ABC3868 is not fully characterized in the provided search results, analysis of its sequence and the general physiology of B. clausii provides insights into potential roles:

• Transport function: As a membrane protein with multiple transmembrane domains, ABC3868 may participate in transport of substrates across the cell membrane, potentially contributing to the strain's environmental adaptability.

• Stress response: B. clausii is known for stress tolerance properties, and ABC3868 might contribute to these mechanisms. Genome analysis of B. clausii strains reveals genes encoding stress-related proteins , and ABC3868 could be among these.

• Probiotic functionality: The protein might be involved in the mechanisms underlying B. clausii's probiotic effects. Studies have shown that B. clausii enhances gut barrier function, demonstrates antimicrobial activity through production of antimicrobial peptides like clausin, and exhibits immunomodulatory properties .

Investigating these potential functions would require functional assays, such as gene knockout studies followed by phenotypic characterization, protein-protein interaction studies, or localization experiments to determine the protein's distribution within the bacterial membrane.

What are the critical factors in designing experiments to study ABC3868 structure-function relationships?

When designing experiments to study structure-function relationships of ABC3868, researchers should consider the following framework:

• Structural analysis preparation:

  • Express and purify protein in sufficient quantities while maintaining native conformation

  • Utilize appropriate detergents or lipid nanodiscs to stabilize the membrane protein

  • Consider cryo-electron microscopy or X-ray crystallography for structural determination

• Mutation strategy:

  • Design site-directed mutagenesis targeting conserved residues across the UPF0059 family

  • Focus on transmembrane regions and potential active sites

  • Create alanine-scanning mutants to systematically assess the functional importance of different residues

• Functional assays:

  • Develop reconstitution systems in proteoliposomes for transport studies

  • Design fluorescence-based assays to monitor conformational changes

  • Establish in vivo complementation assays using B. clausii mutants

• Controls and validation:

  • Include wild-type protein as positive control

  • Use appropriate negative controls (e.g., inactive mutants)

  • Validate results through multiple complementary techniques

This experimental design approach follows the principles of good experimental design as outlined in research methodology resources , ensuring variables are properly controlled and measured.

How can researchers investigate the role of ABC3868 in B. clausii probiotic effects?

Investigating the role of ABC3868 in B. clausii probiotic effects requires a systematic experimental approach:

The methodology should incorporate preclinical research approaches similar to those used in previous B. clausii studies, which have demonstrated effects on gut barrier function, antimicrobial activity, and immunomodulation . For example, researchers have used cell lines like Caco-2 to study how B. clausii protects against cytotoxic effects of pathogens, and similar models could be employed to study ABC3868-specific effects .

What bioinformatic approaches are most informative for analyzing ABC3868 compared to other UPF0059 family proteins?

A comprehensive bioinformatic analysis of ABC3868 should include:

• Sequence analysis and conservation:

  • Multiple sequence alignment of UPF0059 family proteins across bacterial species

  • Identification of conserved motifs and residues using tools like MEME and ConSurf

  • Phylogenetic analysis to establish evolutionary relationships

• Structural prediction and analysis:

  • Secondary structure prediction to identify transmembrane domains

  • Homology modeling based on crystallized structural homologs

  • Molecular dynamics simulations to understand conformational flexibility

• Functional inference:

  • Gene neighborhood analysis to identify functionally related genes

  • Protein-protein interaction network prediction

  • Co-expression analysis using available transcriptomic data from B. clausii

• Integration with experimental data:

  • Map conservation data onto structural models

  • Correlate sequence variations with functional differences observed experimentally

  • Use machine learning approaches to predict substrate specificity based on sequence features

These bioinformatic approaches should be conducted in a systematic manner, with each analysis building upon previous findings to generate testable hypotheses about ABC3868 function within the broader context of membrane biology and B. clausii physiology.

How might ABC3868 contribute to the antimicrobial and immunomodulatory properties of B. clausii?

The potential contribution of ABC3868 to B. clausii's antimicrobial and immunomodulatory properties represents an important avenue for future research. Based on current knowledge of B. clausii functions, several investigative directions emerge:

• Transport of antimicrobial compounds: ABC3868 might be involved in the secretion of antimicrobial peptides such as clausin, which B. clausii strains are known to produce . Research could explore whether ABC3868 knockout affects antimicrobial compound production or export.

• Immune signaling: The protein might participate in interactions with host immune cells. B. clausii has been shown to affect the expression of pro- and anti-inflammatory cytokines and stimulate CD4+ T cell proliferation . Studies could investigate whether ABC3868 serves as a molecular pattern recognized by immune receptors or facilitates the transport of immunomodulatory molecules.

• Barrier function enhancement: B. clausii enhances gut barrier function, including increasing mucin production and tight junction protein synthesis . Research could examine if ABC3868 contributes to these effects through interactions with epithelial cells or by facilitating the export of compounds that strengthen barrier integrity.

Methodologically, these investigations would benefit from combining genetic manipulation of ABC3868 with co-culture systems using immune cells and intestinal epithelial cells to assess functional outcomes.

What comparative genomic insights can be gained by studying ABC3868 across different B. clausii strains?

Comparative genomic analysis of ABC3868 across different B. clausii strains could yield valuable insights into strain-specific adaptations and functional evolution:

• Sequence conservation and variation: Analyze the degree of conservation of ABC3868 across strains like O/C, N/R, SIN, T, B106, UBBC07, and KSM-K16 . Identify strain-specific variations that might correlate with functional differences.

• Genomic context: Examine the genomic neighborhood of ABC3868 in different strains to identify potential operons or functionally related genes that might co-evolve.

• Expression regulation: Compare promoter regions and regulatory elements controlling ABC3868 expression across strains to understand differential regulation under various environmental conditions.

• Correlation with strain-specific properties: Correlate ABC3868 sequence variations with documented strain-specific properties, such as antimicrobial production in UBBC07 or industrial applications of KSM-K16 .

This comparative genomic approach could reveal how ABC3868 has evolved within the B. clausii clade and potentially identify specialized functions that have developed in certain strains, contributing to their specific ecological niches or probiotic properties.

How can structural biology approaches enhance our understanding of ABC3868 function?

Advanced structural biology approaches offer powerful tools for elucidating ABC3868 function:

These structural biology approaches, when combined with functional assays, could provide comprehensive insights into how ABC3868's structure relates to its function in B. clausii physiology and probiotic properties.