KEGG: bcl:ABC1323
STRING: 66692.ABC1323
UPF0295 protein ABC1323 is a 121 amino acid protein from Bacillus clausii with UniProt ID Q5WIE4. The protein's amino acid sequence is MKLKYTNKINKIRTFALSLVFVGILIMYVGIFFKEHPVIMVIAMILGFLAVIASTVVYFFIGLLSTRAVPVICPSCEKQTKVLGRVDACMHCDQPLTMDRSLEGKEFDEAYNSPASKKSQT . Based on the sequence analysis, the protein contains hydrophobic regions suggestive of membrane-spanning domains, particularly in the N-terminal region. The protein belongs to the UPF0295 family, which consists of proteins with unknown function that are conserved across various bacterial species. While detailed three-dimensional structural data is limited, secondary structure predictions suggest a mix of alpha-helical regions (particularly in the transmembrane segments) and beta-sheet structures in the cytoplasmic domains.
The recombinant ABC1323 protein is typically supplied as a lyophilized powder and requires proper handling to maintain its integrity. For optimal storage, the protein should be kept at -20°C/-80°C upon receipt, with aliquoting recommended for multiple use to avoid repeated freeze-thaw cycles . Working aliquots can be stored at 4°C for up to one week, but repeated freezing and thawing is not recommended as it may lead to protein degradation and loss of activity . The protein is typically provided in a Tris/PBS-based buffer containing 6% Trehalose at pH 8.0 . For reconstitution, it is recommended to briefly centrifuge the vial before opening to bring contents to the bottom, then reconstitute in deionized sterile water to a concentration of 0.1-1.0 mg/mL . Adding glycerol to a final concentration of 5-50% (with 50% being the default) is recommended for long-term storage at -20°C/-80°C .
The purity of recombinant ABC1323 is primarily assessed using SDS-PAGE analysis, with commercial preparations typically guaranteeing purity greater than 90% . For more precise purity assessment, researchers should consider complementary analytical techniques such as size-exclusion chromatography (SEC) to evaluate aggregation state and homogeneity. Western blotting using antibodies specific to the His-tag can confirm the identity of the protein while also detecting any degradation products. Mass spectrometry approaches, particularly MALDI-TOF or LC-MS/MS, can provide accurate molecular weight determination and sequence verification. When functional assays for this protein become established, they may also serve as indicators of protein quality beyond mere purity assessments.
The recombinant ABC1323 protein is successfully expressed in E. coli expression systems, particularly with an N-terminal His-tag to facilitate purification . While E. coli remains the predominant expression system due to its simplicity and high yield, researchers should consider the potential effects of the expression host on protein folding and post-translational modifications. For membrane-associated proteins like ABC1323 (based on its sequence characteristics), expression optimization might include testing different E. coli strains (BL21(DE3), Rosetta, etc.), varying induction temperatures (16-37°C), and adjusting IPTG concentrations (0.1-1.0 mM). For researchers requiring higher purity or alternative tag systems, other expression vectors incorporating different affinity tags (e.g., GST, MBP) could be explored, particularly if solubility issues are encountered with the His-tagged construct.
Purification of His-tagged ABC1323 typically employs immobilized metal affinity chromatography (IMAC) using Ni-NTA or similar resins . For optimal purification results, researchers should implement a multi-step purification strategy. Begin with IMAC under native or denaturing conditions depending on protein solubility. Follow with size-exclusion chromatography to remove aggregates and improve homogeneity. If higher purity is required, consider ion-exchange chromatography as an intermediate step between IMAC and SEC. For membrane-associated proteins like ABC1323, addition of mild detergents (0.1% Triton X-100 or 0.05% DDM) to purification buffers may improve solubility and recovery. Monitor purification efficiency at each step using both SDS-PAGE and activity assays (once established) to track both purity and functional integrity throughout the purification process.
When encountering low yield or poor solubility of recombinant ABC1323, researchers should implement a systematic troubleshooting approach. First, optimize expression conditions by testing different E. coli strains, growth temperatures (particularly reducing to 16-18°C during induction), and induction times. For poorly soluble proteins, consider fusion partners known to enhance solubility (MBP, SUMO, or Thioredoxin) rather than simple His-tagging. If the protein appears to form inclusion bodies, evaluate both refolding strategies from solubilized inclusions and native purification with detergents. The addition of molecular chaperones (co-expression of GroEL/ES or DnaK systems) may improve folding efficiency. Modifying buffer compositions by testing different pH values (7.0-8.5), salt concentrations (100-500 mM NaCl), and stabilizing additives (glycerol 5-10%, trehalose 5%) can significantly impact both solubility and stability during purification processes.
The specific biological function of ABC1323 in Bacillus clausii remains largely uncharacterized, as indicated by its UPF (Uncharacterized Protein Family) designation. Based on sequence analysis and the presence of hydrophobic domains, it likely functions as a membrane-associated protein, potentially involved in transport processes or membrane integrity. Comparison with other bacterial species suggests ABC1323 may participate in stress response mechanisms or environmental adaptation, particularly given that B. clausii is known for its probiotic properties and resilience in diverse conditions . The protein contains cysteine residues that could form disulfide bonds or coordinate metal ions, suggesting potential redox activity or structural roles. Future functional studies should explore its interaction with other B. clausii proteins, particularly those identified in secretome analyses of probiotic strains, and its potential role in the organism's documented probiotic effects.
Comparative analysis of ABC1323 with homologs in other Bacillus species reveals both conserved and divergent features that may provide clues to its function. While detailed structural comparison data is limited, sequence alignments show conservation of key hydrophobic regions across related Bacillus proteins, suggesting a preserved membrane-associated function. The UPF0295 family proteins in B. subtilis, B. cereus, and other related species share 70-85% sequence similarity with ABC1323, with the highest conservation in the predicted transmembrane domains. Functional differences may correlate with the distinct ecological niches and probiotic characteristics of B. clausii compared to other Bacillus species. Research approaches should include heterologous expression of ABC1323 homologs from different Bacillus species to compare biochemical properties, localization patterns, and interaction partners, potentially revealing species-specific adaptations in protein function.
To investigate the potential membrane association of ABC1323, researchers should employ multiple complementary experimental approaches. Begin with computational analysis using transmembrane prediction algorithms (TMHMM, Phobius) to identify putative membrane-spanning regions based on the primary sequence. Follow with subcellular fractionation experiments, separating cytoplasmic, periplasmic, and membrane fractions of B. clausii or heterologous expression systems, then perform Western blotting to determine ABC1323 localization. Fluorescence microscopy with GFP-tagged ABC1323 can visualize cellular localization patterns in vivo. For detailed topology analysis, implement techniques such as protease protection assays and site-directed fluorescence labeling at predicted loop regions. To characterize membrane interaction properties, perform liposome binding assays using purified recombinant protein with defined lipid compositions that mimic bacterial membranes. Circular dichroism spectroscopy can provide information about secondary structure changes upon interaction with membrane mimetics.
To identify binding partners of ABC1323, researchers should implement a multi-technique approach. For in vivo studies, consider bacterial two-hybrid systems or proximity labeling approaches using ABC1323 fused to biotin ligase (BioID) expressed in B. clausii. Co-immunoprecipitation experiments using anti-His antibodies can pull down ABC1323 along with its interaction partners from bacterial lysates, followed by mass spectrometry identification. In vitro approaches should include pull-down assays using purified His-tagged ABC1323 immobilized on Ni-NTA resin as bait for proteins from B. clausii lysates. Surface plasmon resonance (SPR) or bio-layer interferometry can be employed to examine binding kinetics with candidate partners. Crosslinking studies using chemical crosslinkers of varying lengths may capture transient interactions. For membrane-associated complexes, consider blue native PAGE to preserve native protein complexes. Computational approaches including protein-protein interaction prediction algorithms can help prioritize candidate interactors for experimental validation.
| Interaction Study Technique | Applications | Advantages | Limitations |
|---|---|---|---|
| Bacterial Two-Hybrid | In vivo detection of direct interactions | Works in bacterial systems, detects direct interactions | May miss weak/transient interactions |
| Co-immunoprecipitation | Isolation of protein complexes | Preserves native complexes, compatible with MS | May lose weak interactions during washing |
| Pull-down Assays | In vitro validation of interactions | Direct control over conditions, quantifiable | Artificial environment may alter interactions |
| Cross-linking MS | Capture of transient interactions | Captures weak/transient interactions | Complex data analysis, potential artifacts |
| SPR/Bio-layer Interferometry | Binding kinetics determination | Real-time kinetic measurements | Requires purified proteins, surface immobilization |
Investigating the physiological role of ABC1323 requires both genetic and biochemical approaches. Generate knockout or knockdown strains of B. clausii lacking ABC1323 using CRISPR-Cas9 or homologous recombination techniques, then conduct comprehensive phenotypic characterization comparing growth rates, stress resistance (pH, temperature, osmotic, oxidative), and membrane integrity under various conditions. Complement these with overexpression studies to identify gain-of-function phenotypes. Metabolomic profiling using LC-MS or NMR can identify metabolic pathways affected by ABC1323 deletion. Transcriptomic analysis (RNA-seq) comparing wild-type and knockout strains will reveal genes whose expression changes in response to ABC1323 deletion, potentially identifying regulatory networks. For functional studies in the context of B. clausii's probiotic properties, assess the impact of ABC1323 deletion on survival in simulated gastrointestinal conditions and adhesion to intestinal epithelial cell models. Monitoring membrane potential, pH homeostasis, and ion transport in wild-type versus knockout strains can provide insights if ABC1323 functions in membrane transport processes.
When designing detection reagents for ABC1323, researchers should first analyze the protein sequence for immunogenic epitopes, avoiding transmembrane regions which tend to be poorly accessible. For antibody production, select 2-3 peptide regions (15-20 amino acids) from predicted extracellular or cytoplasmic domains with high antigenicity scores and low sequence conservation with other proteins. Consider producing antibodies against both N-terminal and C-terminal regions to allow for topology confirmation. For recombinant protein detection, the existing His-tag can be utilized with commercial anti-His antibodies , but researchers should verify specificity in B. clausii lysates to exclude cross-reactivity. When designing nucleic acid probes for ABC1323 detection, analyze the gene sequence for unique regions to ensure specificity. For advanced applications like super-resolution microscopy, site-specific labeling strategies using unnatural amino acid incorporation or enzymatic tags (SNAP, CLIP, Halo) might provide superior spatial resolution compared to conventional antibody labeling.
The potential contribution of ABC1323 to B. clausii's probiotic properties should be investigated in the context of what is known about B. clausii strains used as probiotics (O/C, SIN, N/R, and T strains) . ABC1323, as a putative membrane protein, may play roles in several probiotic-related functions. It could contribute to acid or bile tolerance, critical for survival in the gastrointestinal tract, by participating in membrane stability or adaptation mechanisms. Given that secretome components of B. clausii strains show strain-specific differences , ABC1323 might contribute to the production or regulation of beneficial secreted factors. The protein could potentially influence adhesion to intestinal epithelial cells, competitive exclusion of pathogens, or signaling to host immune cells. To investigate these possibilities, researchers should compare ABC1323 expression levels and sequence variations across the four probiotic B. clausii strains, correlating any differences with strain-specific probiotic properties. Knockout studies followed by in vitro and in vivo models of probiotic function would provide direct evidence of ABC1323's contribution to these properties.
Elucidating the structure-function relationship of ABC1323 requires integrated structural biology approaches. X-ray crystallography would provide atomic-level detail but may be challenging for membrane proteins. Cryo-electron microscopy offers an alternative approach that has revolutionized membrane protein structural biology. For both techniques, researchers must optimize protein purification in appropriate detergents or nanodiscs to maintain native conformation. Nuclear magnetic resonance (NMR) spectroscopy can provide structural information in solution and is particularly valuable for studying protein dynamics. For functional correlation with structure, implement systematic mutagenesis targeting conserved residues, predicted functional domains, and putative active sites. Complementary biophysical techniques including circular dichroism, fluorescence spectroscopy, and thermal shift assays can track structural changes upon mutation or ligand binding. Computational approaches like molecular dynamics simulations can predict structural changes in different environments and identify potential functional sites. Ultimately, correlating structural data with functional outcomes from mutagenesis studies will reveal structure-function relationships critical to understanding ABC1323's biological role.
Investigation of potential post-translational modifications (PTMs) in ABC1323 should begin with computational prediction of modification sites using algorithms specific for bacterial proteins. Mass spectrometry-based approaches provide the most comprehensive experimental strategy for PTM identification. Purify native ABC1323 directly from B. clausii rather than recombinant sources to preserve authentic modifications. Employ enrichment strategies specific to suspected modifications (e.g., phosphopeptide enrichment using titanium dioxide for phosphorylation studies, lectin affinity for glycosylation). Implement both bottom-up (tryptic digestion followed by LC-MS/MS) and top-down (intact protein analysis) proteomics approaches for comprehensive coverage. For specific PTM types, use targeted methods such as Pro-Q Diamond staining for phosphorylation or periodic acid-Schiff staining for glycosylation as preliminary screening tools. Generate site-specific antibodies against predicted modified epitopes for immunological detection. To assess functional significance, create site-directed mutants of modified residues and compare their properties with wild-type protein in relevant assays once the basic function of ABC1323 is better understood.
Differentiating between direct and indirect effects in ABC1323 functional studies requires controlled experimental design and careful data interpretation. Implement time-course experiments to identify primary (rapidly occurring) versus secondary (delayed) effects following ABC1323 perturbation. Compare acute responses using inducible expression/depletion systems versus chronic adaptations in stable knockout lines. For suspected direct interactions, validate with multiple independent techniques such as direct binding assays (SPR, ITC), structural studies showing physical interaction, and reconstitution experiments in simplified systems. When analyzing high-throughput data (transcriptomics, proteomics), differentiate immediate targets from downstream effects using pathway analysis and network modeling. Design rescue experiments where wild-type ABC1323 is reintroduced into knockout strains to confirm direct causality. For testing specific hypotheses about direct effects, develop in vitro assays with purified components to eliminate the complexity of cellular systems. When indirect effects are suspected, map the intermediate steps through sequential knockout or inhibition studies of the proposed pathway components.
Statistical analysis of ABC1323 experimental data should be tailored to specific experimental designs and data types. For comparing phenotypic differences between wild-type and ABC1323 mutant strains, appropriate statistical tests include t-tests for single comparisons or ANOVA with post-hoc tests (Tukey, Bonferroni) for multiple comparisons. When analyzing dose-response relationships or time-course experiments, consider regression analysis or repeated measures ANOVA. For high-throughput omics data, implement multiple testing correction methods (FDR, Bonferroni) to control false discovery rates. Power analysis should be conducted prior to experiments to determine appropriate sample sizes for detecting expected effect sizes. For complex datasets with multiple variables, multivariate statistical approaches such as principal component analysis (PCA) or partial least squares discriminant analysis (PLS-DA) can identify patterns and reduce dimensionality. When analyzing binding kinetics or enzymatic parameters, non-linear regression models appropriate to the specific interaction type should be employed. Regardless of the statistical method, researchers should clearly report effect sizes along with p-values to indicate biological significance beyond statistical significance.
Building comprehensive models of ABC1323 function requires integration of diverse experimental datasets. Begin with construction of a knowledge graph that connects all known information about ABC1323, including sequence features, structural predictions, interaction partners, and phenotypic effects of perturbation. Implement data integration approaches such as Bayesian network analysis to identify conditional dependencies between variables across datasets. For multi-omics integration, techniques such as similarity network fusion or multi-block PLS can reveal relationships between transcriptomic, proteomic, and metabolomic changes associated with ABC1323 function. Machine learning approaches, particularly supervised learning algorithms, can identify patterns across heterogeneous datasets that might not be apparent through conventional analysis. Systems biology modeling, including constraint-based models or ordinary differential equation models, can simulate dynamic behavior based on integrated datasets. Visualization tools such as Cytoscape for network representation or heatmaps for multi-omics data can help communicate complex integrated results. Throughout the integration process, maintain careful documentation of data sources, processing methods, and assumptions to ensure reproducibility and transparency.
The most promising future research directions for ABC1323 characterization include comprehensive structural determination using advanced techniques like cryo-EM or integrated structural biology approaches combining multiple methods. Functional genomics using CRISPR-Cas9 to create precise mutations in B. clausii will help establish the physiological relevance of ABC1323. Interactome mapping using proximity labeling techniques like BioID or APEX would identify the protein's interaction network in its native membrane environment. Investigating the protein's potential role in B. clausii's probiotic effects through targeted studies in relevant model systems could connect basic science with clinical applications. Development of small molecule modulators of ABC1323 function would provide valuable research tools while potentially identifying leads for therapeutic development. Cross-species comparative studies examining ABC1323 homologs in different Bacillus strains could reveal evolutionary adaptations and conserved functions. Finally, integration of all these approaches into a systems biology framework would provide the most comprehensive understanding of this currently uncharacterized protein.
Accelerating understanding of the UPF0295 family proteins requires coordinated community efforts. Establishment of a dedicated consortium focused on uncharacterized protein families would provide structure for collaboration. Development of standardized protocols for expression, purification, and functional characterization would ensure data comparability across laboratories. Creation of a centralized database specifically for UPF0295 family proteins would facilitate data sharing and integration. Organization of focused workshops or conference sessions dedicated to uncharacterized protein families would promote direct collaboration and idea exchange. Implementation of community challenges, similar to CASP (Critical Assessment of Structure Prediction) but focused on function prediction and validation for uncharacterized proteins, would drive innovation in methodologies. Development of shared resources such as antibodies, expression constructs, and knockout strains available through repositories would reduce redundant efforts. Finally, collaborative funding mechanisms specifically supporting research on uncharacterized protein families would incentivize researchers to tackle these challenging but potentially important protein families.
When translating basic findings about ABC1323 to potential applications, researchers should consider several key factors. Intellectual property protection through patents or defensive publications should be addressed early if commercial applications are anticipated. Scalability of production methods must be evaluated, particularly if large quantities of protein or engineered strains will be required for applications. Safety assessments, especially important given B. clausii's use as a probiotic, should include comprehensive toxicity studies and evaluation of antibiotic resistance transfer potential . For potential therapeutic applications, regulatory pathway planning should begin early, recognizing different requirements for probiotics, biologics, or other product categories. Ethical considerations, including potential environmental impacts of engineered strains, should be proactively addressed. Market analysis to identify the most promising applications based on both scientific feasibility and commercial potential will guide resource allocation. Finally, establishment of academic-industry partnerships can accelerate translation by combining basic research expertise with development and commercialization capabilities.