Recombinant Bacillus clausii UPF0316 protein ABC1774 (ABC1774)

Shipped with Ice Packs
In Stock

Description

General Information

Recombinant Bacillus clausii UPF0316 protein ABC1774, also known as ABC1774 protein, is a protein derived from the bacterium Bacillus clausii . Specifically, it is a full-length protein, sourced from the Bacillus clausii UPF0316 protein ABC1774(ABC1774) Protein (Q5WH46) (1-186aa) .

CategoryDescription
SourceE. coli
SpeciesBacillus clausii
SynonymsABC1774, UPF0316 protein ABC1774
UniProt IDQ5WH46
Protein LengthFull Length (1-186aa)
TagHis
PurityGreater than 90% as determined by SDS-PAGE
FormLyophilized powder
StorageStore at -20°C/-80°C upon receipt, avoid freeze-thaw cycles
Storage BufferTris/PBS-based buffer, 6% Trehalose, pH 8.0
ReconstitutionReconstitute in deionized sterile water to 0.1-1.0 mg/mL

Source and Production

The recombinant protein is produced in E. coli and tagged with N-terminal His for purification purposes . The Bacillus clausii strain KSM-K16 is a notable source of this protein .

Amino Acid Sequence

The amino acid sequence of the Recombinant Full Length Bacillus clausii Upf0316 Protein Abc1774(Abc1774) Protein is :
MVLQALIIFFAQLIYVPILTLRTIMMVKGLKQKAAAMGMLEGVIYVVALGIVFSDLSNYYNMAAYALGFGIGLYIGAVIEEKLAIGYVSIEVNIPQKNQPLINRLREMGFSVSSSSVEGMASTRCRLDCTARRDREKEFIKIVSEYEPQAFIVSFEPRNFKGGYITKAMKKRREKYLKRKAKEDAH

Function and Characteristics of Bacillus clausii

Bacillus clausii is a rod-shaped, spore-forming bacterium known for its probiotic properties and ability to survive in harsh conditions, including heat and acid, which facilitates its survival and colonization in the gastrointestinal tract . Bacillus clausii has several characteristics, including:

  • Tolerance to gastric fluids

  • Ability to colonize the gastrointestinal tract

  • Production of riboflavin, which supports cell growth

  • Antimicrobial properties

  • Enhancement of gut barrier function

  • Immunomodulatory activity

Immunomodulatory Effects

Bacillus clausii has demonstrated immunomodulatory roles, influencing the expression of pro- and anti-inflammatory cytokines, and stimulating the proliferation of T cells .

Antibiotic Resistance

Some strains of Bacillus clausii exhibit antibiotic resistance, which can be attributed to chromosomally-encoded genes .

Bacillus clausii and Clinical Applications

Bacillus clausii StrainApplication
SC-109 sporesIncreased production of butyrate, alteration of gut microbiota
UBBC07 sporesReduction of acetaminophen-induced nephrotoxicity
Sinuberase ® live cellsProduction of antimicrobial peptides
UBBC07 live cellsProduction of the lantibiotic clausin
O/CProduction of the lantibiotic clausin
#KCTC 10,277 BP live cellsReduction of inflammation
MTCC-8326 live cellsBalance expression of pro- and anti-inflammatory cytokines, protection from S. typhimurium infections and related toxicity
O/C live cellsProtection from cytotoxic effects of Clostridium difficile and Bacillus cereus
(O/C, N/R, SIN, and T) live cellsIncreased expression of pro-inflammatory cytokines and stimulation of nitrite production and proliferation of CD4+ T cells
O/C live cellsInduction of nitric oxide production
(O/C, N/R, SIN, and T) sporesSlight improvement in symptoms of mild colitis
(O/C, N/R, SIN, and T) sporesReduction of parasitic load and egg load, reduction of inflammation
(O/C, N/R, SIN, and T) sporesReduction in intestinal lesions, debris and immune cell infiltration, increase in mucus-secreting goblet cells

Product Specs

Form
Supplied as a lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your format preference in your order notes for fulfillment.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and the protein's inherent stability.
Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot to prevent repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.
Note: While the tag type is determined during production, please specify your required tag type for preferential development and implementation.
Synonyms
ABC1774; UPF0316 protein ABC1774
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-186
Protein Length
full length protein
Species
Bacillus clausii (strain KSM-K16)
Target Names
ABC1774
Target Protein Sequence
MVLQALIIFFAQLIYVPILTLRTIMMVKGLKQKAAAMGMLEGVIYVVALGIVFSDLSNYY NMAAYALGFGIGLYIGAVIEEKLAIGYVSIEVNIPQKNQPLINRLREMGFSVSSSSVEGM ASTRCRLDCTARRDREKEFIKIVSEYEPQAFIVSFEPRNFKGGYITKAMKKRREKYLKRK AKEDAH
Uniprot No.

Target Background

Database Links

KEGG: bcl:ABC1774

STRING: 66692.ABC1774

Protein Families
UPF0316 family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What expression systems are most effective for producing Recombinant ABC1774 protein?

The primary expression system used for Recombinant Bacillus clausii UPF0316 protein ABC1774 is E. coli. This prokaryotic expression system has proven effective for producing the protein with N-terminal His-tagging, allowing for efficient purification through affinity chromatography .

For optimal expression, researchers should consider:

  • Selecting an appropriate E. coli strain (BL21(DE3) is commonly used for recombinant protein expression)

  • Optimizing induction conditions (IPTG concentration, temperature, and duration)

  • Using a vector with a strong promoter compatible with the chosen E. coli strain

  • Implementing codon optimization if necessary to account for codon usage bias between Bacillus and E. coli

The successful expression yields a protein with purity greater than 90% as determined by SDS-PAGE .

What is the optimal storage and reconstitution methodology for ABC1774 protein stability?

For optimal stability and activity retention of Recombinant ABC1774 protein, the following protocols are recommended:

Storage conditions:

  • Long-term storage: Store at -20°C/-80°C upon receipt

  • Working aliquots: Store at 4°C for up to one week

  • Avoid repeated freeze-thaw cycles as they significantly reduce protein stability

Reconstitution protocol:

  • Briefly centrifuge the vial prior to opening to bring contents to the bottom

  • Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL

  • Add glycerol to 5-50% final concentration (50% is recommended standard)

  • Aliquot into smaller volumes for long-term storage at -20°C/-80°C

Storage buffer composition:

  • Tris/PBS-based buffer

  • 6% Trehalose

  • pH 8.0

This methodology maximizes protein stability while minimizing activity loss during storage and handling procedures.

What experimental approaches can elucidate ABC1774's role in lantibiotic production in B. clausii?

B. clausii produces clausin, a class I lantibiotic with antimicrobial properties. To investigate ABC1774's potential involvement in lantibiotic production or regulation, researchers should consider these methodological approaches:

  • Gene knockout/knockdown studies:

    • Create ABC1774 deletion mutants in B. clausii

    • Quantify lantibiotic production using HPLC and antimicrobial activity assays

    • Compare lantibiotic profiles between wild-type and mutant strains

  • Protein interaction studies:

    • Perform pull-down assays using His-tagged ABC1774

    • Employ bacterial two-hybrid systems to identify protein interactions

    • Use co-immunoprecipitation to detect interactions with known lantibiotic biosynthesis proteins (LanB, LanC, LanD)

  • Transcriptomic analysis:

    • Compare expression profiles of lantibiotic genes in ABC1774 mutants vs. wild-type

    • Use qRT-PCR to quantify expression changes in lantibiotic synthesis genes (lanB, lanC, clausD)

  • Structural studies:

    • Determine if ABC1774 shows structural similarities to known lantibiotic modification enzymes

    • Perform in vitro activity assays with purified ABC1774 against lantibiotic precursors

While genome analysis of B. clausii UBBC07 with BAGEL4 and antiSMASH did not directly implicate ABC1774 in lantibiotic gene clusters , comprehensive functional studies could reveal indirect regulatory roles.

What are the methodological considerations for studying ABC1774's potential membrane interactions?

The amino acid sequence of ABC1774 suggests it may function as a membrane-associated protein. When investigating its membrane interactions, researchers should consider:

  • Membrane topology prediction and validation:

    • Use bioinformatic tools (TMHMM, Phobius, TOPCONS) to predict transmembrane regions

    • Validate predictions experimentally using techniques such as:

      • PhoA/LacZ fusion assays

      • Cysteine accessibility methods

      • Protease protection assays

  • Lipid interaction studies:

    • Perform liposome binding assays with purified ABC1774

    • Use surface plasmon resonance (SPR) to quantify binding affinities to different membrane compositions

    • Employ differential scanning calorimetry to detect lipid phase changes upon protein binding

  • Localization studies:

    • Create fluorescently tagged ABC1774 constructs

    • Perform immunofluorescence microscopy with anti-His antibodies

    • Use fractionation studies to confirm membrane association

  • Functional reconstitution:

    • Reconstitute purified ABC1774 into proteoliposomes

    • Assess potential transport activities across membranes

    • Measure effects on membrane integrity and fluidity

These approaches would provide comprehensive insights into ABC1774's membrane interactions and potentially reveal its functional role within the bacterial cell membrane.

What are the optimal conditions for assessing ABC1774 protein stability and activity?

When designing experiments to evaluate ABC1774 stability and potential functional activity, researchers should consider:

Stability assessment parameters:

  • Temperature stability:

    • Test stability at temperatures ranging from 4°C to 100°C

    • Monitor unfolding using circular dichroism or differential scanning fluorimetry

    • Assess activity retention after thermal stress

  • pH stability:

    • Evaluate stability across pH range 2-11

    • Consider relevance to gastrointestinal conditions if studying probiotic applications

    • B. clausii proteins often show stability in diverse pH conditions, similar to the clausin lantibiotic that maintains stability up to pH 11

  • Protease resistance:

    • Test stability against gastrointestinal proteases (pepsin, trypsin)

    • Evaluate resistance to proteinase K for structural studies

    • Compare protease sensitivity patterns with other B. clausii proteins

  • Activity assays:

    • In the absence of known function, compare activity hypotheses based on structural predictions

    • Consider potential roles in antimicrobial activity, cell adhesion, or signaling

    • Design activity assays based on phenotypic changes in ABC1774 mutants

Experimental controls should include well-characterized proteins with similar molecular weights and structural features.

How can researchers design effective host-microbe interaction studies to investigate ABC1774's role?

To investigate ABC1774's role in host-microbe interactions, consider this methodological framework:

  • In vitro cell culture models:

    • Select appropriate intestinal epithelial cell lines (Caco-2, HT-29)

    • Design experiments comparing wild-type B. clausii vs. ABC1774 mutants

    • Measure endpoints including:

      • Adherence to epithelial cells

      • Cytokine production

      • Epithelial barrier integrity (TEER measurements)

      • Gene expression changes in host cells

  • Ex vivo tissue models:

    • Use intestinal organoids or tissue explants

    • Compare responses to purified ABC1774 protein vs. whole bacteria

    • Assess tissue morphology, secretory responses, and gene expression

  • In vivo approaches:

    • Design animal studies with ABC1774 mutant vs. wild-type B. clausii

    • Consider gnotobiotic models to eliminate confounding microbiota effects

    • Measure immune responses, intestinal barrier function, and gene expression

  • Transcriptomic/proteomic analyses:

    • Perform RNA-seq on host cells exposed to purified ABC1774

    • Compare with whole-genome expression data from B. clausii exposure studies

    • Identify specific pathways influenced by ABC1774 vs. other bacterial components

These approaches would help distinguish ABC1774's specific contributions to the broader immunomodulatory effects observed with B. clausii administration, where significant changes in genes related to immune response, inflammation, and cell signaling have been documented .

What are the optimal purification strategies for obtaining high-purity ABC1774 protein?

For researchers seeking to obtain highly pure ABC1774 protein preparations, the following purification strategy is recommended:

  • Initial purification using affinity chromatography:

    • Utilize the N-terminal His-tag for immobilized metal affinity chromatography (IMAC)

    • Optimize imidazole concentration in binding and elution buffers

    • Consider using cobalt resins for higher specificity than nickel-based resins

  • Secondary purification steps:

    • Size exclusion chromatography to separate monomeric protein from aggregates

    • Ion exchange chromatography as needed for removing contaminants

    • Consider hydrophobic interaction chromatography if membrane-associated impurities persist

  • Quality control assessments:

    • SDS-PAGE analysis (aim for >90% purity)

    • Western blot using anti-His antibodies to confirm identity

    • Mass spectrometry to verify molecular weight (expected ~20 kDa including His-tag)

    • Circular dichroism to assess proper folding

  • Endotoxin removal:

    • Critical for downstream cell-based assays

    • Use methods such as Triton X-114 phase separation or specialized endotoxin removal resins

    • Verify endotoxin levels with LAL assay

This multi-step approach typically yields protein with greater than 90% purity suitable for functional and structural studies.

What methodological approaches can quantify ABC1774 protein expression in different growth conditions?

To accurately quantify ABC1774 expression under varying experimental conditions, researchers should consider these methodological approaches:

  • Transcriptional analysis:

    • qRT-PCR targeting ABC1774 mRNA

    • RNA-seq for whole-transcriptome analysis

    • Design primers specific to the ABC1774 gene sequence

    • Normalize to validated reference genes for B. clausii

  • Protein quantification:

    • Western blotting with anti-His antibodies for recombinant protein

    • Development of ABC1774-specific antibodies for native protein detection

    • ELISA-based quantification for high-throughput analysis

    • Mass spectrometry-based quantitative proteomics (SILAC, TMT, or label-free approaches)

  • Reporter systems:

    • Construction of ABC1774 promoter-reporter fusions (GFP, luciferase)

    • Flow cytometry analysis for single-cell expression levels

    • Real-time monitoring of expression using luciferase reporters

  • Experimental design considerations:

    • Test expression in different growth phases (lag, log, stationary)

    • Vary media compositions to simulate different environmental conditions

    • Consider stress conditions relevant to gastrointestinal transit

    • Compare expression in planktonic vs. biofilm growth states

These approaches would provide comprehensive data on ABC1774 expression regulation under various physiological conditions, potentially revealing its functional significance in different microenvironments.

How can researchers effectively study potential interactions between ABC1774 and host immune receptors?

To investigate potential interactions between ABC1774 and host immune receptors, consider this methodological framework:

  • Protein-protein interaction screening:

    • Yeast two-hybrid screening against immune receptor libraries

    • Protein microarray analysis using purified ABC1774 against immobilized immune receptors

    • Pull-down assays using His-tagged ABC1774 with intestinal cell lysates

    • Surface plasmon resonance to quantify binding kinetics with candidate receptors

  • Cellular response assays:

    • Reporter cell lines expressing specific pattern recognition receptors (TLRs, NLRs)

    • Measure activation of NF-κB, IRF, or MAPK signaling pathways

    • Flow cytometry to assess immune cell activation markers

    • Cytokine production profiles in response to ABC1774 exposure

  • Structural studies:

    • Molecular modeling to predict potential interaction interfaces

    • Mutagenesis of predicted binding sites to confirm interactions

    • Co-crystallization attempts with identified receptor partners

  • In vivo validation:

    • Use receptor knockout models to confirm specificity

    • Compare immune responses to wild-type and mutant ABC1774 proteins

    • Assess downstream effects on gene expression similar to the patterns observed in duodenal biopsies after B. clausii administration

This comprehensive approach would help determine whether ABC1774 contributes to the observed effects of B. clausii on immune response and inflammation gene expression patterns .

How might ABC1774 contribute to the probiotic effects of B. clausii in the gastrointestinal tract?

B. clausii is known to survive and germinate under various gastrointestinal conditions and exhibit probiotic effects. The potential contributions of ABC1774 to these effects can be investigated through:

  • Survival and colonization studies:

    • Compare colonization efficiency between wild-type and ABC1774 mutant B. clausii

    • Assess whether ABC1774 contributes to acid resistance or bile tolerance

    • Determine if ABC1774 affects spore germination rates under intestinal conditions

  • Antimicrobial activity assessment:

    • Investigate whether ABC1774 plays a role in lantibiotic production or regulation

    • Compare antimicrobial activity profiles of wild-type and ABC1774 mutant strains against pathogenic bacteria like C. difficile

    • Assess potential contributions to competitive exclusion of pathogens

  • Immunomodulatory effects:

    • Compare immunomodulatory properties between wild-type and ABC1774 mutants

    • Assess effects on cytokine production and inflammatory markers

    • Determine contributions to the gene expression changes observed in intestinal mucosa after B. clausii administration

  • Interactions with other microbiota:

    • Study ABC1774's role in inter-species communication

    • Assess effects on microbiome composition in vivo

    • Investigate potential quorum sensing mechanisms

Understanding ABC1774's specific contributions would help elucidate the molecular mechanisms underlying B. clausii's beneficial effects in conditions like C. difficile-associated diarrhea .

What research approaches could identify evolutionary conservation of ABC1774 across Bacillus species?

To understand the evolutionary significance of ABC1774, researchers should consider:

  • Comparative genomic analysis:

    • Perform BLAST searches against other Bacillus genomes

    • Identify orthologs across related species

    • Compare synteny of surrounding genomic regions

    • Assess conservation of protein domains and motifs

  • Phylogenetic analysis:

    • Construct phylogenetic trees of ABC1774 orthologs

    • Compare with species phylogeny to identify potential horizontal gene transfer events

    • Calculate selection pressures (dN/dS ratios) to identify conserved functional regions

  • Structural comparison:

    • Model structures of identified orthologs

    • Compare predicted structural elements across species

    • Identify structurally conserved regions that may indicate functional importance

  • Functional complementation:

    • Express ABC1774 orthologs from different species in B. clausii ABC1774 mutants

    • Assess functional complementation to determine conservation of activity

    • Identify species-specific differences in function

This evolutionary perspective would provide insight into the protein's fundamental biological significance and potential specialized adaptations in B. clausii.

What methodological approaches could elucidate the structural characteristics of ABC1774?

To determine the structural features of ABC1774 protein, researchers should consider these complementary approaches:

  • X-ray crystallography:

    • Optimize conditions for protein crystallization

    • Consider membrane mimetics if transmembrane domains are present

    • Use molecular replacement with structural homologs as search models

    • Aim for resolution sufficient to identify potential active sites

  • NMR spectroscopy:

    • Particularly useful if the protein has flexible regions

    • Isotopic labeling (15N, 13C) for structural determination

    • Study dynamics of potential membrane-interacting regions

    • Investigate ligand binding through chemical shift perturbation

  • Cryo-electron microscopy:

    • Appropriate for larger complexes or membrane-associated forms

    • Single-particle analysis for structure determination

    • Visualization of protein in native-like lipid environments

  • Computational approaches:

    • Homology modeling based on related structures

    • Molecular dynamics simulations to study conformational dynamics

    • Ab initio modeling for regions lacking homology to known structures

    • Prediction of functional sites based on evolutionary conservation

  • Biophysical characterization:

    • Circular dichroism to determine secondary structure content

    • Small-angle X-ray scattering for solution structure

    • Analytical ultracentrifugation to assess oligomeric state

    • Thermal shift assays to identify stabilizing conditions

These structural insights would significantly advance understanding of ABC1774's function and potential mechanisms of action in bacterial physiology and host interactions.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.