Recombinant Bacillus clausii UPF0316 protein ABC1774, also known as ABC1774 protein, is a protein derived from the bacterium Bacillus clausii . Specifically, it is a full-length protein, sourced from the Bacillus clausii UPF0316 protein ABC1774(ABC1774) Protein (Q5WH46) (1-186aa) .
The recombinant protein is produced in E. coli and tagged with N-terminal His for purification purposes . The Bacillus clausii strain KSM-K16 is a notable source of this protein .
The amino acid sequence of the Recombinant Full Length Bacillus clausii Upf0316 Protein Abc1774(Abc1774) Protein is :
MVLQALIIFFAQLIYVPILTLRTIMMVKGLKQKAAAMGMLEGVIYVVALGIVFSDLSNYYNMAAYALGFGIGLYIGAVIEEKLAIGYVSIEVNIPQKNQPLINRLREMGFSVSSSSVEGMASTRCRLDCTARRDREKEFIKIVSEYEPQAFIVSFEPRNFKGGYITKAMKKRREKYLKRKAKEDAH
Bacillus clausii is a rod-shaped, spore-forming bacterium known for its probiotic properties and ability to survive in harsh conditions, including heat and acid, which facilitates its survival and colonization in the gastrointestinal tract . Bacillus clausii has several characteristics, including:
Bacillus clausii has demonstrated immunomodulatory roles, influencing the expression of pro- and anti-inflammatory cytokines, and stimulating the proliferation of T cells .
Some strains of Bacillus clausii exhibit antibiotic resistance, which can be attributed to chromosomally-encoded genes .
KEGG: bcl:ABC1774
STRING: 66692.ABC1774
The primary expression system used for Recombinant Bacillus clausii UPF0316 protein ABC1774 is E. coli. This prokaryotic expression system has proven effective for producing the protein with N-terminal His-tagging, allowing for efficient purification through affinity chromatography .
For optimal expression, researchers should consider:
Selecting an appropriate E. coli strain (BL21(DE3) is commonly used for recombinant protein expression)
Optimizing induction conditions (IPTG concentration, temperature, and duration)
Using a vector with a strong promoter compatible with the chosen E. coli strain
Implementing codon optimization if necessary to account for codon usage bias between Bacillus and E. coli
The successful expression yields a protein with purity greater than 90% as determined by SDS-PAGE .
For optimal stability and activity retention of Recombinant ABC1774 protein, the following protocols are recommended:
Storage conditions:
Long-term storage: Store at -20°C/-80°C upon receipt
Working aliquots: Store at 4°C for up to one week
Avoid repeated freeze-thaw cycles as they significantly reduce protein stability
Reconstitution protocol:
Briefly centrifuge the vial prior to opening to bring contents to the bottom
Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL
Add glycerol to 5-50% final concentration (50% is recommended standard)
Aliquot into smaller volumes for long-term storage at -20°C/-80°C
Storage buffer composition:
This methodology maximizes protein stability while minimizing activity loss during storage and handling procedures.
B. clausii produces clausin, a class I lantibiotic with antimicrobial properties. To investigate ABC1774's potential involvement in lantibiotic production or regulation, researchers should consider these methodological approaches:
Gene knockout/knockdown studies:
Create ABC1774 deletion mutants in B. clausii
Quantify lantibiotic production using HPLC and antimicrobial activity assays
Compare lantibiotic profiles between wild-type and mutant strains
Protein interaction studies:
Transcriptomic analysis:
Structural studies:
Determine if ABC1774 shows structural similarities to known lantibiotic modification enzymes
Perform in vitro activity assays with purified ABC1774 against lantibiotic precursors
While genome analysis of B. clausii UBBC07 with BAGEL4 and antiSMASH did not directly implicate ABC1774 in lantibiotic gene clusters , comprehensive functional studies could reveal indirect regulatory roles.
The amino acid sequence of ABC1774 suggests it may function as a membrane-associated protein. When investigating its membrane interactions, researchers should consider:
Membrane topology prediction and validation:
Use bioinformatic tools (TMHMM, Phobius, TOPCONS) to predict transmembrane regions
Validate predictions experimentally using techniques such as:
PhoA/LacZ fusion assays
Cysteine accessibility methods
Protease protection assays
Lipid interaction studies:
Perform liposome binding assays with purified ABC1774
Use surface plasmon resonance (SPR) to quantify binding affinities to different membrane compositions
Employ differential scanning calorimetry to detect lipid phase changes upon protein binding
Localization studies:
Create fluorescently tagged ABC1774 constructs
Perform immunofluorescence microscopy with anti-His antibodies
Use fractionation studies to confirm membrane association
Functional reconstitution:
Reconstitute purified ABC1774 into proteoliposomes
Assess potential transport activities across membranes
Measure effects on membrane integrity and fluidity
These approaches would provide comprehensive insights into ABC1774's membrane interactions and potentially reveal its functional role within the bacterial cell membrane.
When designing experiments to evaluate ABC1774 stability and potential functional activity, researchers should consider:
Stability assessment parameters:
Temperature stability:
Test stability at temperatures ranging from 4°C to 100°C
Monitor unfolding using circular dichroism or differential scanning fluorimetry
Assess activity retention after thermal stress
pH stability:
Protease resistance:
Activity assays:
In the absence of known function, compare activity hypotheses based on structural predictions
Consider potential roles in antimicrobial activity, cell adhesion, or signaling
Design activity assays based on phenotypic changes in ABC1774 mutants
Experimental controls should include well-characterized proteins with similar molecular weights and structural features.
To investigate ABC1774's role in host-microbe interactions, consider this methodological framework:
In vitro cell culture models:
Select appropriate intestinal epithelial cell lines (Caco-2, HT-29)
Design experiments comparing wild-type B. clausii vs. ABC1774 mutants
Measure endpoints including:
Adherence to epithelial cells
Cytokine production
Epithelial barrier integrity (TEER measurements)
Gene expression changes in host cells
Ex vivo tissue models:
Use intestinal organoids or tissue explants
Compare responses to purified ABC1774 protein vs. whole bacteria
Assess tissue morphology, secretory responses, and gene expression
In vivo approaches:
Design animal studies with ABC1774 mutant vs. wild-type B. clausii
Consider gnotobiotic models to eliminate confounding microbiota effects
Measure immune responses, intestinal barrier function, and gene expression
Transcriptomic/proteomic analyses:
Perform RNA-seq on host cells exposed to purified ABC1774
Compare with whole-genome expression data from B. clausii exposure studies
Identify specific pathways influenced by ABC1774 vs. other bacterial components
These approaches would help distinguish ABC1774's specific contributions to the broader immunomodulatory effects observed with B. clausii administration, where significant changes in genes related to immune response, inflammation, and cell signaling have been documented .
For researchers seeking to obtain highly pure ABC1774 protein preparations, the following purification strategy is recommended:
Initial purification using affinity chromatography:
Utilize the N-terminal His-tag for immobilized metal affinity chromatography (IMAC)
Optimize imidazole concentration in binding and elution buffers
Consider using cobalt resins for higher specificity than nickel-based resins
Secondary purification steps:
Size exclusion chromatography to separate monomeric protein from aggregates
Ion exchange chromatography as needed for removing contaminants
Consider hydrophobic interaction chromatography if membrane-associated impurities persist
Quality control assessments:
Endotoxin removal:
Critical for downstream cell-based assays
Use methods such as Triton X-114 phase separation or specialized endotoxin removal resins
Verify endotoxin levels with LAL assay
This multi-step approach typically yields protein with greater than 90% purity suitable for functional and structural studies.
To accurately quantify ABC1774 expression under varying experimental conditions, researchers should consider these methodological approaches:
Transcriptional analysis:
qRT-PCR targeting ABC1774 mRNA
RNA-seq for whole-transcriptome analysis
Design primers specific to the ABC1774 gene sequence
Normalize to validated reference genes for B. clausii
Protein quantification:
Western blotting with anti-His antibodies for recombinant protein
Development of ABC1774-specific antibodies for native protein detection
ELISA-based quantification for high-throughput analysis
Mass spectrometry-based quantitative proteomics (SILAC, TMT, or label-free approaches)
Reporter systems:
Construction of ABC1774 promoter-reporter fusions (GFP, luciferase)
Flow cytometry analysis for single-cell expression levels
Real-time monitoring of expression using luciferase reporters
Experimental design considerations:
Test expression in different growth phases (lag, log, stationary)
Vary media compositions to simulate different environmental conditions
Consider stress conditions relevant to gastrointestinal transit
Compare expression in planktonic vs. biofilm growth states
These approaches would provide comprehensive data on ABC1774 expression regulation under various physiological conditions, potentially revealing its functional significance in different microenvironments.
To investigate potential interactions between ABC1774 and host immune receptors, consider this methodological framework:
Protein-protein interaction screening:
Yeast two-hybrid screening against immune receptor libraries
Protein microarray analysis using purified ABC1774 against immobilized immune receptors
Pull-down assays using His-tagged ABC1774 with intestinal cell lysates
Surface plasmon resonance to quantify binding kinetics with candidate receptors
Cellular response assays:
Reporter cell lines expressing specific pattern recognition receptors (TLRs, NLRs)
Measure activation of NF-κB, IRF, or MAPK signaling pathways
Flow cytometry to assess immune cell activation markers
Cytokine production profiles in response to ABC1774 exposure
Structural studies:
Molecular modeling to predict potential interaction interfaces
Mutagenesis of predicted binding sites to confirm interactions
Co-crystallization attempts with identified receptor partners
In vivo validation:
This comprehensive approach would help determine whether ABC1774 contributes to the observed effects of B. clausii on immune response and inflammation gene expression patterns .
B. clausii is known to survive and germinate under various gastrointestinal conditions and exhibit probiotic effects. The potential contributions of ABC1774 to these effects can be investigated through:
Survival and colonization studies:
Compare colonization efficiency between wild-type and ABC1774 mutant B. clausii
Assess whether ABC1774 contributes to acid resistance or bile tolerance
Determine if ABC1774 affects spore germination rates under intestinal conditions
Antimicrobial activity assessment:
Immunomodulatory effects:
Interactions with other microbiota:
Study ABC1774's role in inter-species communication
Assess effects on microbiome composition in vivo
Investigate potential quorum sensing mechanisms
Understanding ABC1774's specific contributions would help elucidate the molecular mechanisms underlying B. clausii's beneficial effects in conditions like C. difficile-associated diarrhea .
To understand the evolutionary significance of ABC1774, researchers should consider:
Comparative genomic analysis:
Perform BLAST searches against other Bacillus genomes
Identify orthologs across related species
Compare synteny of surrounding genomic regions
Assess conservation of protein domains and motifs
Phylogenetic analysis:
Construct phylogenetic trees of ABC1774 orthologs
Compare with species phylogeny to identify potential horizontal gene transfer events
Calculate selection pressures (dN/dS ratios) to identify conserved functional regions
Structural comparison:
Model structures of identified orthologs
Compare predicted structural elements across species
Identify structurally conserved regions that may indicate functional importance
Functional complementation:
Express ABC1774 orthologs from different species in B. clausii ABC1774 mutants
Assess functional complementation to determine conservation of activity
Identify species-specific differences in function
This evolutionary perspective would provide insight into the protein's fundamental biological significance and potential specialized adaptations in B. clausii.
To determine the structural features of ABC1774 protein, researchers should consider these complementary approaches:
X-ray crystallography:
Optimize conditions for protein crystallization
Consider membrane mimetics if transmembrane domains are present
Use molecular replacement with structural homologs as search models
Aim for resolution sufficient to identify potential active sites
NMR spectroscopy:
Particularly useful if the protein has flexible regions
Isotopic labeling (15N, 13C) for structural determination
Study dynamics of potential membrane-interacting regions
Investigate ligand binding through chemical shift perturbation
Cryo-electron microscopy:
Appropriate for larger complexes or membrane-associated forms
Single-particle analysis for structure determination
Visualization of protein in native-like lipid environments
Computational approaches:
Homology modeling based on related structures
Molecular dynamics simulations to study conformational dynamics
Ab initio modeling for regions lacking homology to known structures
Prediction of functional sites based on evolutionary conservation
Biophysical characterization:
Circular dichroism to determine secondary structure content
Small-angle X-ray scattering for solution structure
Analytical ultracentrifugation to assess oligomeric state
Thermal shift assays to identify stabilizing conditions
These structural insights would significantly advance understanding of ABC1774's function and potential mechanisms of action in bacterial physiology and host interactions.