Recombinant Bacillus clausii UPF0756 membrane protein ABC2716 (ABC2716)

Shipped with Ice Packs
In Stock

Description

Protein Identification and Classification

Recommended name: UPF0756 membrane protein ABC2716 (hypothetical designation based on naming conventions)
Gene locus: ABC2716 (ordered locus name)
UniProt ID: Not available in current records

Genomic Context and Homology

If ABC2716 followed patterns observed in other B. clausii membrane proteins (e.g., ABC1774 [Q5WH46] ):

FeatureTypical Characteristics in B. clausii Membrane Proteins
Gene locationChromosomal
Protein familyUPF (Uncharacterized Protein Family)
Conserved domainsPredicted transmembrane helices, ATP-binding motifs
HomologyLikely shares ancestry with Bacillus transport systems

Recombinant Production Protocol (Hypothetical)

Based on methodologies for similar B. clausii proteins :

Expression system:

  • Host: Escherichia coli (BL21 or similar strains)

  • Vector: pET or pQE series with His-tag

  • Induction: IPTG at OD₆₀₀ ≈ 0.6

Purification:

  • Immobilized metal affinity chromatography (IMAC)

  • Buffer: Tris/PBS with 50% glycerol for stabilization

Biochemical Characterization (Expected Parameters)

Modeled after UPF0316 protein ABC1774 :

ParameterValue
Molecular weight~21 kDa (calculated)
Isoelectric point (pI)5.8–6.2
ThermostabilityStable at 4°C for 1 week

Functional Annotations (Speculative)

Given B. clausii's probiotic mechanisms , ABC2716 might contribute to:

  • Antimicrobial activity: Through bacteriocin-like domains

  • Stress tolerance: Acid/bile resistance modules

  • Host interaction: Adhesion proteins (e.g., fibronectin-binding)

Research Gaps and Recommendations

  1. Sequence validation: No genome assemblies in the search results include ABC2716.

  2. Functional studies: Absence of in vitro/in vivo data on this protein.

  3. Taxonomic clarification: "UPF0756" designation doesn’t align with standard UPF numbering in Bacillus spp.

Product Specs

Form
Lyophilized powder
Please note: We prioritize shipping the format currently in stock. If you have specific format requirements, please indicate them in your order. We will fulfill your request to the best of our ability.
Lead Time
Delivery time may vary depending on the purchase method and location. Please contact your local distributor for specific delivery timeframes.
Please note: Our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance. Additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial prior to opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%, which can be used as a reference.
Shelf Life
Shelf life is influenced by various factors including storage conditions, buffer composition, temperature, and the intrinsic stability of the protein.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple use. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type will be determined during production. If you have a specific tag type requirement, please inform us, and we will prioritize the development of your specified tag.
Synonyms
ABC2716; UPF0756 membrane protein ABC2716
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-157
Protein Length
full length protein
Species
Bacillus clausii (strain KSM-K16)
Target Names
ABC2716
Target Protein Sequence
MLSQSTLFLLLLMAIALIAKNQSLIIAISVLLLIKWTGLGDKVFPLMQAKGINLGVTIIT IAVLVPIATGDIGFKQLGEATKSLYAWVALGSGIAVALVAASGIDLLKNDPHITAALVLG TIVAVSFLNGVAVGPLIGAGIAYLTMRAIQYIAQLWG
Uniprot No.

Target Background

Database Links

KEGG: bcl:ABC2716

STRING: 66692.ABC2716

Protein Families
UPF0756 family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is Bacillus clausii and why is it significant in probiotic research?

Bacillus clausii is a spore-forming, gram-positive bacterium widely used as a probiotic in commercial formulations. Several strains including ENTPro, B106, and UBBC07 have been studied for their probiotic properties . B. clausii is particularly notable for its ability to form spores that can survive the harsh conditions of the gastrointestinal tract, enabling it to reach the intestine in viable form. Genome analysis of B. clausii strains reveals considerable heterogeneity at both species and genus levels, with genomic similarities between probiotic strains (ENTPro, B106, UBBC07) ranging from 94-99%, while other members of the same species show only 50-94% similarity .

B. clausii strains are significant in probiotic research because they possess genes coding for bacteriocins like gallidermin, which can prevent biofilm formation in pathogenic bacteria such as Staphylococcus aureus and S. epidermidis. Furthermore, the genome contains various antibiotic resistance genes, stress-related domains, and adhesion-related domains that facilitate survival in the gastrointestinal environment .

What is the UPF0756 membrane protein family and how does ABC2716 fit within it?

The UPF0756 protein family represents uncharacterized protein family 0756, a classification for membrane proteins whose functions have not been fully determined experimentally. The ABC2716 protein from B. clausii belongs to this family and is likely involved in membrane-associated functions that contribute to the probiotic properties of the bacterium.

While the search results don't provide specific information about ABC2716, studies of membrane proteins in probiotic bacteria show they often play crucial roles in adhesion to intestinal mucosa, environmental stress response, and interaction with host cells. Based on genomic analysis of B. clausii ENTPro, several membrane proteins have been identified with domains that facilitate adhesion to gut epithelium, including mucus-binding proteins with 'Gram_pos_anchor' domains [PF00746], collagen-binding proteins with LPXTG motifs, and fibronectin-binding proteins .

How does the genomic context of ABC2716 compare across different B. clausii strains?

Comparative genomic analysis of B. clausii strains reveals significant genomic heterogeneity. The ENTPro strain shares 94.3% similarity with B. clausii KSM-K16 and higher similarity with other probiotic strains like B106 and UBBC07 . While specific information about the genomic context of ABC2716 is not provided in the search results, this heterogeneity suggests potential variations in the sequence and regulation of membrane proteins across different strains.

The phylogenetic analysis places B. clausii probiotic strains (ENTPro, B106, UBBC07) in a distinct clade separate from industrial strains like KSM-K16, suggesting evolutionary adaptations specific to probiotic function . For researchers studying ABC2716, it would be important to analyze the gene sequence, flanking regions, and regulatory elements across multiple B. clausii strains to understand strain-specific variations that might impact protein function.

What expression systems are optimal for producing recombinant B. clausii membrane proteins?

For recombinant expression of bacterial membrane proteins, Escherichia coli-based systems often provide the best balance of yield and proper folding. Drawing from methodologies used for other bacterial membrane proteins, successful expression typically involves:

  • Vector selection: pRSET vectors with T7 promoters provide high-level expression for bacterial membrane proteins, as demonstrated with the PorB protein .

  • E. coli strain selection: JM101 or BL21(DE3) strains are commonly used for membrane protein expression. For the PorB outer membrane protein, researchers used E. coli JM101 transformed with the expression vector .

  • Induction conditions: IPTG induction (typically 1mM) followed by bacteriophage infection can enhance expression, as shown in the PorB study where cultures were induced with IPTG for 1 hour and then infected with M13/T7 phage (10 PFU/ml) for 5 hours .

  • Growth conditions: Using enriched media such as superbroth (25g Bacto-Tryptone, 15g yeast extract, and 5g NaCl per liter) with appropriate antibiotics and vigorous shaking (200 rpm) at 37°C until optimal cell density is reached (typically A600 of 0.3) .

For membrane proteins specifically, expression levels should be carefully controlled to prevent aggregation and misfolding. Lower temperatures (16-30°C) during induction may improve proper folding of membrane proteins.

What purification strategies maximize yield and native conformation of recombinant ABC2716?

Purification of recombinant membrane proteins requires strategies that maintain their native conformation while achieving high purity. Based on successful approaches with other bacterial membrane proteins:

  • Affinity chromatography: Incorporating a His-tag in the recombinant construct allows purification using nickel or cobalt affinity resins. The PorB study used affinity chromatography to purify the recombinant protein to homogeneity .

  • Detergent selection: Critical for maintaining membrane protein structure. Zwitterionic detergents like LDAO or non-detergent sulfobetaines have been successful for bacterial membrane proteins. These were used in the PorB study for creating micelles that preserved native conformation .

  • Refolding strategies: If inclusion bodies form, controlled refolding protocols using detergents or lipid bilayers can help recover native structure. For PorB, incorporation into liposomes and micelles composed of zwitterionic detergent or non-detergent sulfobetaine proved effective .

  • Quality control: Circular dichroism spectroscopy and thermal stability assays can verify proper folding of the purified membrane protein.

The type of downstream application should guide purification strategy selection. For structural studies, higher purity is essential, while functional studies may require milder conditions that better preserve native conformation.

How can researchers verify the proper folding and functionality of recombinant ABC2716?

Verifying proper folding and functionality of recombinant membrane proteins requires multiple complementary approaches:

  • Immunological recognition: Compare antibody recognition of the recombinant protein versus the native protein in outer membranes. For PorB, researchers measured reactivity with native protein using enzyme immunoassay with outer membranes and whole-cell immunofluorescence .

  • Biophysical characterization:

    • Circular dichroism spectroscopy to assess secondary structure content

    • Thermal shift assays to evaluate stability

    • Size exclusion chromatography to verify monodispersity and appropriate oligomeric state

  • Functional assays: Develop specific assays based on predicted functions. For membrane proteins involved in adhesion, bacterial adhesion inhibition assays could be employed.

  • Incorporation into artificial membranes: Successful incorporation into liposomes often indicates proper folding of membrane proteins. In the PorB study, incorporation into liposomes and micelles was crucial for maintaining native conformation and generating antibodies that recognized the native protein in a serotype-specific manner .

  • ELISA binding assays: Using antibodies against conformational epitopes to verify structural integrity. The PorB study used ELISA with anti-mouse immunoglobulin-horseradish peroxidase (HRP) conjugate to detect antibody binding to the recombinant protein .

A properly folded ABC2716 would be expected to maintain its predicted transmembrane topology and any functional domains essential for its biological activity.

How should researchers design immunogenicity studies with recombinant ABC2716?

Designing effective immunogenicity studies for recombinant membrane proteins requires careful consideration of several factors:

  • Adjuvant selection and formulation strategies:

    • Compare multiple formulations: Test the protein adsorbed to traditional adjuvants (Al(OH)₃), incorporated into liposomes, and formulated in micelles

    • Include immunostimulatory molecules: Addition of monophosphoryl lipid A to liposome or micelle preparations can significantly enhance reactivity with native protein

    • Test different protein-to-lipid ratios in liposomal formulations

  • Immunization protocols:

    • Route: Subcutaneous or intraperitoneal administration

    • Schedule: Primary immunization followed by 2-3 booster doses at 2-3 week intervals

    • Dosage: Typically 20-50 μg of protein per immunization

  • Assessment of immune response:

    • Quantify antibody titers using ELISA with both recombinant and native protein

    • Evaluate antibody functionality through in vitro assays

    • Assess recognition of native protein via whole-cell immunofluorescence

  • Data collection and analysis:

    • ELISA titer calculation: Extract from the linear portion of the serum titration curve, defined as the dilution giving an absorbance increase of 0.1 units per hour

    • Statistical comparison between different formulations

Formulation TypeAdvantagesConsiderationsExample Measurement Method
Al(OH)₃ adsorptionSimple preparationLimited conformational preservationELISA titer against purified recombinant protein
LiposomesPreserves membrane protein conformationMore complex preparationWhole-cell immunofluorescence and ELISA with outer membranes
Detergent micellesGood for structural epitopesMay form heterogeneous particlesImmunoblotting with native protein preparations

Based on studies with other bacterial membrane proteins, liposomal formulations with added immunostimulants often produce antibodies with superior recognition of the native protein in its original context .

What approaches can be used to study structure-function relationships in ABC2716?

Studying structure-function relationships in membrane proteins like ABC2716 requires integrated approaches:

  • Primary sequence analysis:

    • Identify conserved domains using Pfam database

    • Perform multiple sequence alignments with homologous proteins

    • Use hydropathy analysis to predict transmembrane regions

  • Structural biology techniques:

    • X-ray crystallography (challenging for membrane proteins)

    • Cryo-electron microscopy for larger membrane protein complexes

    • NMR spectroscopy for specific domains

    • Molecular modeling based on homologous proteins with known structures

  • Mutagenesis approaches:

    • Site-directed mutagenesis of conserved residues

    • Creation of chimeric proteins by domain swapping with related proteins

    • Generation of truncation mutants to identify functional domains

  • Functional correlation:

    • Develop quantitative assays for predicted functions (e.g., adhesion assays if believed to be involved in host attachment)

    • Compare wild-type and mutant proteins in these assays

    • Correlate structural features with functional outcomes

  • In silico approaches:

    • Molecular dynamics simulations to study protein-membrane interactions

    • Protein-protein interaction predictions

    • Evolutionary analysis to identify functionally important residues

Combining these approaches allows researchers to build a comprehensive understanding of how specific structural elements in ABC2716 contribute to its biological function in B. clausii.

How can ABC2716 be studied in the context of B. clausii probiotic functions?

To investigate ABC2716's role in B. clausii probiotic functions, researchers should consider:

  • Gene knockout or knockdown studies:

    • Create ABC2716-deficient strains using CRISPR-Cas9 or traditional homologous recombination

    • Compare phenotypes of wild-type and mutant strains in:

      • Gastrointestinal survival assays

      • Adhesion to intestinal epithelial cells

      • Biofilm formation capabilities

      • Competitive fitness in simulated gut environments

  • Simulated gastrointestinal environment studies:

    • Use Simulator of Human Intestinal Microbial Ecosystem (SHIME) to assess survival and germination under various conditions

    • Test wild-type and ABC2716-modified strains under both fed and fasted conditions

    • Measure expression levels of ABC2716 under different gastrointestinal stressors

  • Protein localization studies:

    • Use fluorescent protein fusions or immunogold electron microscopy to determine the precise cellular localization of ABC2716

    • Examine whether localization changes under different environmental conditions

  • Host interaction studies:

    • Investigate if antibodies against ABC2716 block adhesion to intestinal cells

    • Assess immune responses to ABC2716 in intestinal epithelial cells or immune cells

    • Determine if ABC2716 interacts with specific host receptors or molecules

  • Comparative genomics approach:

    • Compare ABC2716 sequences across different B. clausii strains with varying probiotic efficacy

    • Correlate sequence variations with differences in probiotic functions

By integrating these approaches, researchers can build a comprehensive understanding of ABC2716's contribution to B. clausii's probiotic properties and potentially identify novel mechanisms for enhancing probiotic effectiveness.

How do modifications to ABC2716 affect B. clausii survival in the gastrointestinal tract?

The survival of B. clausii in the gastrointestinal tract depends on several factors, including resistance to acids, bile salts, and antimicrobial peptides. Membrane proteins like ABC2716 may contribute to these resistance mechanisms. To investigate this:

  • Create modified variants of ABC2716:

    • Site-directed mutagenesis of conserved residues

    • Domain deletions or substitutions

    • Expression level modifications (overexpression or knockdown)

  • Test survival under simulated gastrointestinal conditions:

    • Acid resistance (pH 2-4 for varying time periods)

    • Bile salt tolerance (0.3-2% bile concentrations)

    • Resistance to digestive enzymes (pepsin, pancreatin)

    • Survival in Simulator of Human Intestinal Microbial Ecosystem (SHIME)

  • Quantitative analysis protocols:

    • Measure viable cell counts at different time points

    • Quantify spore versus vegetative cell ratios

    • Evaluate membrane integrity using fluorescent dyes

    • Assess gene expression changes under stress conditions

  • Correlation with structural features:

    • Identify which structural domains are critical for survival

    • Determine if post-translational modifications affect function

    • Investigate protein-protein interactions under stress conditions

Preliminary research suggests that B. clausii spores show remarkable survival in simulated human intestinal conditions, with studies on the UBBC07 strain demonstrating successful transit through the upper GI tract to reach the intestine in viable form . Understanding how ABC2716 contributes to this survival capability could provide insights for engineering improved probiotic strains.

What techniques best resolve contradictory results in ABC2716 functional studies?

When facing contradictory results in functional studies of membrane proteins like ABC2716, researchers should employ the following approaches:

  • Standardization of experimental conditions:

    • Establish consistent protein preparation protocols across laboratories

    • Define standard buffer compositions, pH, and temperature conditions

    • Create reference material batches for cross-laboratory validation

  • Orthogonal method validation:

    • Employ multiple independent techniques to assess the same property

    • Compare results from in vitro, ex vivo, and in vivo systems

    • Use both recombinant systems and native expression contexts

  • Sensitivity analysis:

    • Systematically vary experimental parameters to identify variables causing discrepancies

    • Determine threshold conditions where functional changes occur

    • Quantify variability between experimental replicates

  • Advanced statistical approaches:

    • Meta-analysis of multiple independent studies

    • Bayesian statistical methods to integrate prior knowledge with new data

    • Principal component analysis to identify patterns in complex datasets

  • Collaborative cross-validation:

    • Establish multi-laboratory validation studies

    • Implement blinded testing protocols

    • Use standardized reporting formats for methodological details

For example, when studying membrane protein conformation, discrepancies might arise between antibody recognition assays and functional tests. Researchers with the PorB membrane protein resolved such contradictions by testing multiple formulations (Al(OH)₃, liposomes, and micelles) and using multiple readouts including ELISA, whole-cell immunofluorescence, and functional bactericidal assays .

How can researchers leverage -omics approaches to understand ABC2716 in the broader context of B. clausii biology?

Integrating multiple -omics approaches provides comprehensive insights into membrane protein function within the broader biological context:

  • Genomics approaches:

    • Comparative genomics across B. clausii strains to identify variations in ABC2716 sequence

    • Analysis of genomic context and potential operonic organization

    • Identification of regulatory elements controlling ABC2716 expression

  • Transcriptomics applications:

    • RNA-seq to determine expression patterns under different conditions

    • Identification of co-regulated genes suggesting functional relationships

    • Assessment of differential expression in wild-type versus mutant strains

  • Proteomics strategies:

    • Quantitative proteomics to measure ABC2716 abundance in different conditions

    • Protein-protein interaction studies using pull-down assays and mass spectrometry

    • Post-translational modification analysis

  • Metabolomics integration:

    • Correlate metabolite profiles with ABC2716 expression levels

    • Identify metabolic pathways affected by ABC2716 modification

    • Measure changes in extracellular metabolites when ABC2716 is altered

  • Systems biology modeling:

    • Integrate multi-omics data into comprehensive models

    • Predict effects of ABC2716 modifications on cellular function

    • Identify network hubs and bottlenecks affected by ABC2716

What strategies help overcome solubility and stability issues with recombinant ABC2716?

Membrane proteins present unique challenges in recombinant expression and purification. The following strategies can help overcome common problems:

  • Expression optimization:

    • Test multiple fusion tags (His, GST, MBP, SUMO) for improved solubility

    • Evaluate expression at reduced temperatures (16-25°C) to slow folding

    • Use specialized E. coli strains designed for membrane protein expression

    • Consider cell-free expression systems for highly toxic membrane proteins

  • Solubilization approaches:

    • Screen different detergent classes:

      • Mild non-ionic detergents (DDM, LMNG)

      • Zwitterionic detergents (LDAO, CHAPSO)

      • Non-detergent sulfobetaines as used for PorB

    • Test detergent mixtures and novel amphipathic polymers

    • Optimize detergent-to-protein ratios

  • Stability enhancement:

    • Add specific lipids that may stabilize the native conformation

    • Incorporate cholesterol or other sterols if beneficial

    • Test addition of osmolytes (glycerol, sucrose, arginine)

    • Consider nanodiscs or liposomes for improved stability

  • Storage considerations:

    • Determine optimal buffer compositions to prevent aggregation

    • Establish appropriate temperature conditions (4°C, -20°C, -80°C)

    • Evaluate freeze-thaw stability and need for cryoprotectants

    • Consider lyophilization protocols if appropriate

ChallengeStrategyImplementationEvaluation Method
Inclusion body formationRefolding from inclusion bodiesSolubilization in 8M urea followed by stepwise dialysisSDS-PAGE and Western blot
Aggregation during purificationDetergent screeningTest panel of 8-12 different detergents at critical micelle concentrationSize exclusion chromatography
Conformational heterogeneityLiposome incorporationReconstitution into defined lipid compositionsCircular dichroism spectroscopy
Limited stabilityBuffer optimizationSystematic variation of pH, salt, and additivesThermal shift assays

For PorB, researchers successfully maintained native conformation by incorporating the protein into liposomes and micelles, which proved essential for generating antibodies that recognized the native protein .

How can researchers optimize ABC2716 for structural studies?

Preparing membrane proteins like ABC2716 for structural studies requires specialized approaches:

  • Construct optimization:

    • Remove flexible regions that may hinder crystallization

    • Create fusion constructs with crystallization chaperones (T4 lysozyme, BRIL)

    • Generate antibody fragment complexes to stabilize specific conformations

    • Design minimal functional constructs by removing non-essential domains

  • Expression and purification optimization:

    • Scale up production in bioreactors for adequate protein yields

    • Implement multi-step purification including ion exchange and size exclusion chromatography

    • Assess protein monodispersity using dynamic light scattering

    • Verify protein stability over time to ensure sample consistency

  • Crystallization approaches:

    • Screen diverse crystallization conditions using automated systems

    • Test lipidic cubic phase crystallization for membrane proteins

    • Explore detergent/lipid mixtures that promote crystal contacts

    • Implement microseeding techniques to improve crystal quality

  • Alternative structural methods:

    • Cryo-electron microscopy for larger membrane proteins

    • NMR spectroscopy for smaller membrane proteins or domains

    • Small-angle X-ray scattering for envelope determination

    • Hydrogen-deuterium exchange mass spectrometry for dynamics

  • Quality control metrics:

    • Use size exclusion chromatography-multi-angle light scattering (SEC-MALS) to assess oligomeric state

    • Thermal stability assays to identify stabilizing conditions

    • Functional assays to verify that structural preparations retain activity

The success of structural studies often depends on identifying conditions that balance protein stability, homogeneity, and the ability to form crystal contacts or generate high-quality particles for cryo-EM analysis.

What controls are essential when studying ABC2716 interactions with host cells?

When investigating membrane protein interactions with host cells, rigorous controls are essential:

  • Protein preparation controls:

    • Purified protein negative control (denatured protein)

    • Related protein from the same family with different function

    • Blocked protein (pre-incubation with antibodies or ligands)

    • Concentration gradients to establish dose-dependency

  • Cell line considerations:

    • Multiple relevant cell lines (intestinal epithelial cells, immune cells)

    • Primary cells versus immortalized lines

    • Polarized versus non-polarized cultures

    • Validation in 3D organoid models

  • Experimental design controls:

    • Time course experiments to distinguish kinetic differences

    • Temperature controls (4°C vs. 37°C) to differentiate active versus passive processes

    • Metabolic inhibitors to block specific cellular pathways

    • Competitive inhibition with known ligands

  • Visualization and quantification methods:

    • Multiple complementary techniques (flow cytometry, microscopy, biochemical assays)

    • Fluorescently labeled protein with appropriate fluorophore controls

    • Live cell imaging to capture dynamic interactions

    • Quantitative image analysis with appropriate statistical testing

  • Functional validation:

    • Gene knockdown/knockout of proposed receptors

    • Site-directed mutagenesis of interaction domains

    • Blocking antibodies against specific epitopes

    • Downstream signaling assays to confirm functional relevance

For B. clausii proteins involved in adhesion, research has identified specific domains including 'Gram_pos_anchor', collagen-binding proteins with LPXTG motifs, and fibronectin-binding proteins . Similar approaches would be valuable for studying ABC2716 interactions, with appropriate controls to distinguish specific binding from non-specific associations.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.