Recombinant Bacillus halodurans DNA translocase FtsK (ftsK)

Shipped with Ice Packs
In Stock

Description

Introduction to Recombinant Bacillus halodurans DNA Translocase FtsK (ftsK)

Recombinant Bacillus halodurans DNA translocase FtsK (ftsK) is a bioengineered version of the native FtsK protein, a hexameric ATP-dependent DNA motor critical for bacterial chromosome segregation. The recombinant variant retains structural and functional homology to its native counterpart, enabling studies on DNA translocation, chromosome dimer resolution, and interactions with recombination machinery. Key features include its His-tagged N-terminal domain, full-length expression (1–789 amino acids), and compatibility with in vitro assays for ATPase activity and DNA binding .

Domain Architecture

FtsK consists of three conserved subdomains:

DomainFunctionKey Features
αβATPase motorRecA-like fold; hexameric assembly; couples ATP hydrolysis to DNA translocation .
γRegulatory domainWinged-helix structure; binds KOPS (8-bp DNA motifs); directs translocation polarity .

The γ domain in Bacillus halodurans FtsK binds G-rich sequences analogous to KOPS (FtsK Orienting Polar Sequences) in E. coli, though specific motifs vary between species .

ATPase and DNA Translocation Activity

  • ATPase Activity: FtsK exhibits ATP hydrolysis rates comparable to homologs (e.g., E. coli FtsK ~5 kb/s) .

  • Translocation Directionality: Governed by γ domain interactions with KOPS, ensuring movement toward replication termini (e.g., dif sites) .

  • Mechanistic Insights:

    • Preferential loading at KOPS sites in ADP-bound state .

    • Directional translocation once engaged, with no rerecognition of KOPS during movement .

Functional Validation

  • KOPS Binding: Binds E. coli KOPS (GGGCAGGG) with sequence-specific affinity .

  • Recombinase Activation: Stimulates tyrosine recombinases (e.g., XerCD) for chromosome dimer resolution .

Homology to Other FtsK Proteins

OrganismKey FeatureFunctional Role
E. coliRecognizes G-rich KOPSSegregates chromosomes via dif-site recombination .
D. radioduransForms dynamic foci at septum/nucleoidCoordinates genome segregation and cell division .
B. haloduransFull-length recombinant availableInferred role in chromosome organization (limited direct studies) .

Functional Hypotheses for B. halodurans FtsK

  • Chromosome Segregation: Likely pumps septum-trapped DNA during cell division, similar to E. coli .

  • Radiation Resistance: D. radiodurans FtsK upregulates post-irradiation; analogous stress-response potential in B. halodurans .

Biotechnological Potential

  • Genome Engineering: Utilized in synthetic biology for directed DNA movement or chromosome partitioning.

  • Enzyme Studies: Serves as a model for understanding ATP-dependent translocation mechanisms.

Challenges and Future Directions

  • Limited Characterization: Direct studies on B. halodurans FtsK are scarce; functional data inferred from homologs.

  • Structural Dynamics: High-resolution imaging (e.g., DNA curtains) needed to map translocation mechanisms .

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format we have in stock. However, if you have a specific format requirement, please indicate it in your order. We will fulfill your request if possible.
Lead Time
Delivery time may vary depending on the purchase method and location. Please contact your local distributor for specific delivery time information.
Note: All of our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging this vial before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard final concentration of glycerol is 50%, which you may use as a reference.
Shelf Life
The shelf life depends on several factors, including storage conditions, buffer composition, temperature, and the protein's inherent stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
ftsK; spoIIIE; BH2395; DNA translocase FtsK
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-789
Protein Length
full length protein
Species
Bacillus halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125)
Target Names
ftsK
Target Protein Sequence
MAKRKKKKKVAWQSQLTFELVGLGILVIAVVALAQLGTVGETLVRLFRFFLGEWYAVLSI ALLVAALYIMVKREKPPLWSRRIGGLYLMLLSALLFSHVGLFGQLQGNEGFSDQSVIRNT WNLFWLDMYGEVQHSDLGGGMIGAIAYAASHFLFADGGTLFLCFILFMAGLILLTGHSIT DLFGKAIRRTYLWVVDFIKGTWNEWKQFRKESKEKLEQDRKLLKERKEKKAAKRSRNEDP AQEENDQPLEIVDFSQRVSHEAKNDATVKQQVKPAKQEDQVSKEAPEEDKLASQGQEGEE MPTVSLATAVTPNDDYQLPTIELLKLPNNPNQSMEKRLLHKNAEKLRKTLESFGVKAHVS KVHLGPAVTKYEVNPHVGVKVSRIVNLADDLALALAAKDIRIEAPIPGKSAIGIEVPNQE VAIVTLREVLDSPQAKADRNVLSVGLGRDISGEPVFAPLNKMPHLLVAGATGSGKSVCIN GIITSILLKAKPHEVKLMMIDPKMVELNVYNGIPHLLTPVVTEPKKASQALKKVVAEMER RYDLFSHSGTRNIEGYNEMITRQNEKEDAKQPTLPYIVVIVDELADLMMVASGDVEDSIA RLAQMARAAGIHMILATQRPSVDVITGVIKANIPSRIAFGVSSQTDSRTILDTGGAEKLL GRGDMLYLPMGATKPTRVQGAFLSDEEVETIVEFVVAQQKAQYAEEMTPTEETKVTEKVD DELYDDAVNLVIEMNSASVSMLQRRFRIGYTRAARLIDEMEARGIVGPYEGSKPREVLVQ AQDDEASSH
Uniprot No.

Target Background

Function
Essential cell division protein that coordinates cell division and chromosome segregation. The N-terminus is involved in the assembly of the cell-division machinery. The C-terminus functions as a DNA motor that moves dsDNA in an ATP-dependent manner towards the dif recombination site, which is located within the replication terminus region. This protein is required for activation of the Xer recombinase, enabling activation of chromosome unlinking by recombination.
Database Links

KEGG: bha:BH2395

STRING: 272558.BH2395

Protein Families
FtsK/SpoIIIE/SftA family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is FtsK and what is its primary function in bacterial cells?

FtsK is a double-stranded DNA translocase that converts the chemical energy of ATP binding and hydrolysis into mechanical movement of DNA substrates. This remarkable molecular motor moves DNA at an extraordinary rate of over 5000 base pairs per second and is powerful enough to remove other proteins from the DNA during translocation . In bacteria, FtsK localizes to the site of cell division (the septum) where it functions as a DNA pump during the late stages of the cell cycle to expedite cytokinesis and chromosome segregation . The protein's N-terminus is involved in cell-cycle-specific localization and assembly of the cell-division machinery, while the C-terminus forms the motor that drives DNA movement .

What is the structural organization of Bacillus halodurans FtsK protein?

Bacillus halodurans FtsK is a 789-amino acid protein with distinct functional domains . The protein's motor portion can be divided into three subdomains:

  • α domain - contributes to hexamer formation

  • β domain - contributes to hexamer formation and contains the ATPase active site

  • γ domain - provides directionality through sequence recognition

The α and β domains multimerize to produce a hexameric ring with a central channel for dsDNA and contain a RecA-like nucleotide-binding/hydrolysis fold . This hexameric assembly is critical for the protein's translocation activity. The regulatory γ domain binds to polarized chromosomal sequences (KOPS - 5'-GGGNAGGG-3') to ensure that the motor loads onto DNA in a specific orientation, directing translocation toward the terminus region of the chromosome .

How does FtsK differ from other DNA translocases in Bacillus species?

Unlike Escherichia coli, which primarily relies on a single FtsK protein, Bacillus subtilis contains two FtsK/SpoIIIE-like proteins: SpoIIIE and SftA (formerly YtpS) . These proteins have diverged functionally:

  • SftA plays a role similar to E. coli FtsK during each cell cycle but cannot substitute for SpoIIIE in rescuing trapped chromosomes .

  • SftA colocalizes with FtsZ at nascent division sites but not with SpoIIIE at sites of chromosome trapping .

  • SpoIIIE primarily functions in post-septational chromosome segregation, especially during spore development .

The presence of two FtsK/SpoIIIE paralogs is not universal among endospore-forming bacteria but is highly conserved within several groups of soil- and plant-associated bacteria . This specialization suggests evolutionary adaptation to specific ecological niches.

What are the optimal conditions for storing and handling recombinant Bacillus halodurans FtsK protein?

Proper storage and handling of recombinant B. halodurans FtsK are essential for maintaining its activity. The recommended storage and handling conditions are:

ParameterRecommendationNotes
Long-term storage-20°C or -80°CAliquoting necessary for multiple use
Working storage4°CFor up to one week
Storage bufferTris/PBS-based, 6% Trehalose, pH 8.0Optimized for stability
ReconstitutionDeionized sterile water (0.1-1.0 mg/mL)Add 5-50% glycerol for long-term storage
Freeze-thaw cyclesAvoid repeated cyclesCan cause protein denaturation

For optimal results, centrifuge the vial briefly before opening to bring contents to the bottom . After reconstitution, the default final concentration of glycerol recommended is 50% . The purity of commercially available recombinant protein is typically greater than 90% as determined by SDS-PAGE .

What experimental approaches can be used to study FtsK assembly on DNA?

Studying the assembly of FtsK hexamers on DNA requires sophisticated experimental approaches:

  • Triplex displacement assays: These monitor the kinetics of FtsK assembly and translocation by measuring the displacement of triplex-forming oligonucleotides from DNA substrates. Studies have shown that FtsK hexamers assemble onto KOPS by a six-step process, where each step involves the association of an FtsK monomer .

  • Gel-shift assays: To detect the formation of stable FtsK-DNA complexes under various conditions (e.g., with/without ATP, different salt concentrations).

  • Electron microscopy: To directly visualize hexameric assemblies on DNA substrates with and without KOPS sites.

  • Fluorescence resonance energy transfer (FRET): By labeling individual FtsK subunits and DNA, researchers can monitor the assembly process in real-time.

When designing these experiments, it's critical to note that at concentrations above 50 nM, FtsK shows largely nonspecific initiation , which may complicate the analysis of sequence-specific assembly mechanisms.

How can I measure the translocation activity of recombinant FtsK protein?

The translocation activity of recombinant FtsK can be assessed using several complementary approaches:

  • ATP hydrolysis assays: Since FtsK translocation is coupled to ATP hydrolysis, measuring ATPase activity provides an indirect measure of translocation. This can be done using colorimetric assays (e.g., malachite green) or coupled enzyme assays (e.g., pyruvate kinase/lactate dehydrogenase system).

  • Single-molecule techniques: Optical or magnetic tweezers allow real-time observation of FtsK-mediated DNA movement and measurement of forces generated during translocation. When designing these experiments, be aware that detection requirements like loop extrusion can select for artifactual events involving multiple motors .

  • Fluorescence-based assays: Using fluorescently labeled DNA substrates to track changes in fluorescence intensity or anisotropy during translocation.

  • Triplex displacement kinetics: These assays can provide detailed kinetic parameters for both assembly and translocation. Analysis has shown that after assembly, FtsK translocation is "blind" to KOPS sequences .

For robust results, include appropriate controls such as ATP-depleted conditions, non-hydrolyzable ATP analogs, and catalytically inactive protein variants to confirm that observed activity is specifically due to FtsK translocation.

How can I investigate the directional control mechanism of FtsK translocation?

Investigating the directional control mechanism of FtsK requires experiments targeting the sequence-specific recognition of KOPS sites by the γ domain:

  • KOPS-dependent assembly assays: Compare assembly rates on DNA substrates containing KOPS sites in different orientations. Kinetic analysis has shown that FtsK hexamers assemble specifically at KOPS sequences through a stepwise process .

  • Domain swap experiments: Replace the γ domain of FtsK with sequence-specific DNA binding domains from other proteins to assess how directional control is achieved.

  • Site-directed mutagenesis: Introduce specific mutations in the γ domain to identify residues critical for KOPS recognition.

  • KOPS scanning experiments: Use DNA substrates with KOPS sites at different positions to determine how the location of these sites affects translocation direction and efficiency.

  • Single-molecule tracking: Fluorescently label FtsK and DNA to directly visualize directional movement in real-time.

These approaches can help elucidate how FtsK achieves its remarkable directional movement toward the chromosome terminus region and specifically to the 28 bp dif site located in this region .

What approaches can be used to study the ATP coupling mechanism in FtsK motor function?

Understanding how ATP binding and hydrolysis drive FtsK translocation requires sophisticated mechanistic studies:

  • Pre-steady-state kinetic analysis: Rapid kinetic methods like stopped-flow or quenched-flow can resolve individual steps in the ATP hydrolysis cycle and their coupling to translocation.

  • Nucleotide analogs: Using ATP analogs that mimic different states in the hydrolysis cycle (ATP, ATPγS, ADP-AlF4, ADP) can trap the motor in specific conformational states.

  • Subunit coordination studies: Introducing mutations that affect ATP binding or hydrolysis in specific subunits can reveal how the six subunits coordinate their activities during translocation.

  • Single-molecule force measurements: These can determine the mechanical work performed per ATP hydrolyzed, providing insights into the energetic coupling ratio for translocation .

  • Structural studies: Cryo-electron microscopy of FtsK-DNA complexes in different nucleotide-bound states can reveal conformational changes associated with the mechanochemical cycle.

These approaches can help determine how FtsK achieves its remarkable translocation rate of >5000 bp per second through efficient coupling of ATP hydrolysis to mechanical movement.

How can I study the interaction between FtsK and the XerCD recombination system?

Investigating the interaction between FtsK and the XerCD recombination system requires a combination of biochemical, genetic, and structural approaches:

  • Protein-protein interaction assays:

    • Co-immunoprecipitation to detect physical interactions

    • Bacterial two-hybrid assays to map interaction domains

    • Surface plasmon resonance to measure binding kinetics and affinities

  • In vitro recombination assays:

    • Reconstituted systems with purified FtsK, XerC, XerD, and dif-containing DNA

    • Analysis of how FtsK activation affects the kinetics of XerCD-mediated recombination

    • Assessment of how ATP binding and hydrolysis by FtsK influence XerCD activity

  • Domain mapping experiments:

    • Truncation analysis to identify the regions of FtsK that interact with XerCD

    • Mutational analysis of candidate interaction residues

    • Peptide competition assays to disrupt specific interactions

  • Structural studies:

    • X-ray crystallography or cryo-EM of FtsK-XerCD-DNA complexes

    • Hydrogen-deuterium exchange mass spectrometry to map interaction surfaces

These approaches can help elucidate how FtsK activates XerCD-mediated recombination at the dif site after completing its translocation to the terminus region of the chromosome .

How can I distinguish between specific and non-specific DNA binding during FtsK assembly studies?

Distinguishing between specific (KOPS-dependent) and non-specific DNA binding is critical for accurate interpretation of FtsK assembly data:

  • Comparative binding assays:

    • Use DNA substrates with and without KOPS sites

    • Compare binding affinities and kinetics under identical conditions

    • Apply competition assays with specific and non-specific DNA

  • Kinetic analysis:

    • Specific assembly at KOPS shows distinct kinetic signatures

    • The hexamerization process at KOPS sites proceeds through a defined six-step assembly pathway

    • At concentrations >50 nM, FtsK exhibits largely nonspecific initiation

  • Mutational approaches:

    • Use FtsK variants with mutations in the γ domain that impair KOPS recognition

    • Compare these to wild-type protein on the same DNA substrates

  • Salt dependency:

    • Specific protein-DNA interactions are typically more resistant to increasing salt concentrations than non-specific interactions

    • Perform binding assays across a range of salt concentrations

When analyzing data, remember that after initiation, FtsK translocation becomes "blind" to KOPS sequences , so timing is critical when assessing specificity in dynamic translocation assays.

What are common challenges in expressing and purifying functional recombinant FtsK protein?

Expressing and purifying functional FtsK presents several challenges that researchers should anticipate:

  • Solubility issues:

    • FtsK contains membrane-associated regions that can cause aggregation

    • Solution: Express only the motor domain (C-terminal portion) or use fusion tags that enhance solubility

  • Maintaining hexameric structure:

    • The active form of FtsK is a hexamer, which may dissociate during purification

    • Solution: Include ATP or non-hydrolyzable analogs during purification to stabilize the complex

  • Protein activity:

    • FtsK may lose activity during purification or storage

    • Solution: Optimize buffer conditions, consider including DNA in storage buffers, and add glycerol to prevent freezing damage

  • Expression toxicity:

    • Overexpression of DNA-binding proteins can be toxic to host cells

    • Solution: Use tightly controlled inducible systems and optimize induction conditions (temperature, duration, inducer concentration)

  • Protein heterogeneity:

    • Mixed oligomeric states can complicate biochemical analyses

    • Solution: Include size-exclusion chromatography as a final purification step

For Bacillus halodurans FtsK specifically, expression in E. coli has been successful , but careful optimization of expression and purification conditions is essential for obtaining functional protein.

What statistical approaches are appropriate for analyzing kinetic data from FtsK translocation assays?

Analyzing kinetic data from FtsK translocation assays requires sophisticated statistical approaches:

  • Model selection and validation:

    • Compare multiple kinetic models using Akaike Information Criterion (AIC) or F-tests

    • Use residual analysis to assess goodness-of-fit

    • Validate models with independent experiments

  • Parameter estimation:

    • Use non-linear regression for fitting rate equations

    • Apply bootstrap or jackknife methods to estimate confidence intervals

    • Consider global fitting approaches for multiple datasets

  • Single-molecule data analysis:

    • Apply hidden Markov modeling for state transitions

    • Use change-point algorithms to detect pauses or direction changes

    • Analyze dwell-time distributions to extract rate constants

  • Handling multi-phase kinetics:

    • FtsK assembly and translocation often show multiple phases

    • Decompose complex kinetic profiles into constituent phases

    • Relate phases to specific molecular events in the translocation cycle

When analyzing translocation data, remember that reversal events at nonpermissive KOPS seen in some single-molecule tweezers assays may be artifacts of experimental design rather than physiologically relevant events .

How does Bacillus halodurans FtsK compare with FtsK proteins from other bacterial species?

Comparative analysis of FtsK proteins across bacterial species reveals both conserved features and species-specific adaptations:

  • Domain organization:

    • The three-domain architecture (N-terminal, linker, C-terminal motor) is widely conserved

    • Bacillus halodurans FtsK consists of 789 amino acids , while homologs in other species may vary in length

    • The motor domains (α, β, γ) show the highest sequence conservation

  • Functional specialization:

    • In E. coli, a single FtsK protein handles all DNA translocation tasks

    • In B. subtilis, functions are divided between SpoIIIE and SftA

    • SftA plays a role similar to E. coli FtsK during each cell cycle

    • SpoIIIE specializes in post-septational chromosome rescue

  • Sequence recognition:

    • The specific DNA sequences recognized by the γ domain may vary between species

    • E. coli FtsK recognizes KOPS (5'-GGGNAGGG-3')

    • The mechanism of directional control appears to be conserved

  • Phylogenetic distribution:

    • Having two FtsK/SpoIIIE paralogs is highly conserved within several groups of soil- and plant-associated bacteria

    • This suggests adaptation to specific ecological niches or life cycles

These comparisons can provide insights into how FtsK has evolved to meet the specific needs of different bacterial species while maintaining its core DNA translocation function.

What can we learn about the co-evolution of FtsK with chromosome organization and cell division systems?

The evolutionary relationship between FtsK and other cellular systems reveals how chromosome management is integrated with cell division:

  • FtsK and the divisome:

    • FtsK's N-terminus interacts with cell division proteins

    • In B. subtilis, SftA colocalizes with FtsZ at nascent division sites

    • These associations suggest co-evolution of DNA translocases with the cell division machinery

  • FtsK and the XerCD-dif system:

    • FtsK activates XerCD recombinases at the dif site

    • This interaction requires co-evolutionary adaptation between these systems

    • The coupled operation ensures chromosome dimer resolution before cell division completes

  • FtsK and homologous recombination:

    • SftA mutants divide over unsegregated chromosomes more frequently than wild-type unless recA is inactivated

    • This suggests co-evolution between DNA translocases and recombination machineries

    • FtsK may have evolved to resolve chromosome topological problems created by recombination

  • Specialization after gene duplication:

    • The presence of both SpoIIIE and SftA in Bacillus species represents functional divergence after duplication

    • SftA functions during normal cell cycles while SpoIIIE specializes in emergency chromosome rescue

    • This specialization may reflect adaptation to the complex life cycle of endospore-forming bacteria

These co-evolutionary relationships highlight how FtsK functions as part of an integrated system for chromosome management during bacterial cell division.

How might research on FtsK contribute to our understanding of other DNA motor proteins?

Research on FtsK provides valuable insights applicable to other DNA motor proteins:

  • Mechanistic principles:

    • FtsK belongs to the AAA+ superfamily of ring-shaped ATPases

    • Findings about FtsK's hexameric assembly pathway may inform models for other hexameric motors

    • The energetic coupling ratio estimated for FtsK translocation provides a benchmark for other DNA-translocating motors

  • Directional control:

    • The mechanism by which FtsK's γ domain confers directionality may have parallels in other directional motors

    • The concept of sequence-specific loading followed by sequence-blind translocation may apply to other systems

  • Experimental approaches:

    • Methods developed to study FtsK assembly and translocation can be adapted for other motor proteins

    • Awareness of potential artifacts in single-molecule studies of FtsK informs better experimental design for related motors

  • Evolutionary relationships:

    • Comparing FtsK with other DNA translocases reveals how motor functions have been adapted for different cellular tasks

    • The specialization seen in Bacillus species provides a model for understanding functional divergence after gene duplication

These insights from FtsK research contribute to a broader understanding of how molecular motors convert chemical energy into mechanical work and how they are integrated into complex cellular processes.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.