Recombinant Bacillus halodurans L-arabinose transport system permease protein AraQ (araQ)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them during order placement. We will fulfill your request if possible.
Lead Time
Delivery time may vary depending on the purchase method and location. Please consult your local distributors for specific delivery estimates.
Note: All our proteins are shipped with standard blue ice packs. If dry ice shipping is required, please contact us in advance. Additional fees may apply.
Notes
Repeated freezing and thawing is not recommended. For optimal preservation, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We suggest adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by various factors including storage conditions, buffer components, temperature, and the inherent stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. For lyophilized form, the shelf life is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
araQ; BH0903; Arabinooligosaccharides transport system permease protein AraQ
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-279
Protein Length
full length protein
Species
Bacillus halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125)
Target Names
araQ
Target Protein Sequence
MKRKTSPILSWLLTIGFAFIAFIAVFPLLNLILASFRPSTELMRNGITLIFDPSTLTLDN FIYIFTEAGLYWTWFGNSVWISIVIVVLSLLFSSMVGYALAVYDFKGRNFFFLLVLIILM IPFEILMLPLFQLMIKLQLVNTYTAVILPAIVAPIAVFFFRQYALGLPKELMDAARIDGC TEYGIFFKIMLPLMGPSLAAMAILQGLNSWNNFLWPLVVLRSNDMFTLPIGLATLLTPYG NNYDILLAGSVMTIVPIVILFIFFQRYFIAGLTVGGVKG
Uniprot No.

Target Background

Function
AraQ is a component of the ABC transporter complex AraNPQ involved in the uptake of arabinooligosaccharides. It is responsible for the translocation of the substrate across the membrane.
Database Links

KEGG: bha:BH0903

STRING: 272558.BH0903

Protein Families
Binding-protein-dependent transport system permease family, MalFG subfamily
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is the biological role of AraQ in Bacillus halodurans L-arabinose transport?

AraQ is a transmembrane permease component of the ABC-type L-arabinose transporter in B. halodurans. It partners with AraP (substrate-binding lipoprotein) and AraEGH (ATPase components) to facilitate the energy-dependent uptake of arabinose and arabino-oligosaccharides . Methodologically, its function is validated through growth assays under arabinose-limiting conditions. For example, deletion of araQ reduces growth rates by 5-fold in media containing arabinotriose as the sole carbon source . Structural studies reveal that AraQ contains a conserved C-terminal tail (e.g., -GVKG motif) critical for interaction with the MsmX ATPase, which energizes the transport system .

What protocols are used to express and purify recombinant AraQ?

Recombinant AraQ is typically expressed in E. coli or yeast systems with affinity tags (e.g., His₆) for purification. Key steps include:

  • Cloning: The araQ gene (BH0903, UniProt Q9KEE9) is amplified from B. halodurans genomic DNA and ligated into vectors like pET or pYES under inducible promoters .

  • Expression: Induction with IPTG (for E. coli) or galactose (for yeast) at 20–25°C to minimize inclusion body formation .

  • Purification: Immobilized metal affinity chromatography (IMAC) followed by size-exclusion chromatography to isolate monomeric or oligomeric forms .
    Critical parameters include maintaining a Tris-based buffer (pH 7.5–8.0) with 50% glycerol for storage stability .

How is AraQ’s transport activity experimentally validated?

Functional validation involves uptake assays and growth phenotyping:

  • Radiolabeled substrate uptake: Cells expressing AraQ are incubated with ³H-labeled L-arabinose or arabinotriose. Transport rates are quantified via scintillation counting .

  • Growth curves: Strains lacking araQaraQ) show impaired growth in minimal media with arabinose derivatives (Table 1) .

Table 1. Impact of araQ mutations on arabinotriose uptake in B. subtilis

StrainDoubling Time (min)Arabinotriose Uptake Efficiency
Wild-type98.2 ± 10.0100% (baseline)
ΔaraQ472.8 ± 22.617%
araQ<sup>D180A</sup>149.3 ± 12.832%

How do specific mutations in AraQ alter substrate transport kinetics?

Site-directed mutagenesis of conserved residues (e.g., D180A in the C-terminal tail) disrupts MsmX ATPase binding, reducing transport efficiency . Methodology:

  • Mutagenesis: Overlap PCR introduces point mutations (e.g., D180A) into araQ .

  • Functional assays: Compare growth rates (Table 1) and substrate affinity (K<sub>m</sub>) via Michaelis-Menten kinetics.

  • Structural analysis: Molecular dynamics simulations predict destabilization of helix-helix interactions in the transmembrane domain (TMD) .

What structural features enable AraQ-MsmX ATPase interaction?

AraQ’s C-terminal tail (-GVKG motif) binds the Q-loop of MsmX, as shown by:

  • Truncation studies: Deleting the last four residues (ΔGVKG) reduces arabinotriose uptake by 83% .

  • Cross-linking assays: Chemical cross-linkers (e.g., DSS) confirm physical interaction between AraQ and MsmX in membrane fractions .

  • Homology modeling: AraQ’s cytoplasmic domain shares 64% similarity with E. coli MalG, which forms analogous ATPase interactions .

How does AraQ integrate into the broader arabinose regulon?

AraQ is transcriptionally regulated by AraR, which represses araQ expression in the absence of L-arabinose . Key findings:

  • DNA footprinting: AraR binds cooperatively to two operator sites (OR<sub>A1</sub>, OR<sub>A2</sub>) upstream of araQ, inducing DNA looping .

  • Induction mechanism: L-arabinose binding to AraR reduces its DNA affinity by 10<sup>3</sup>-fold, derepressing araQ transcription .

  • Cross-regulation: AraQ also transports D-xylose and D-galactose, linking it to catabolic pathways beyond arabinose .

What discrepancies exist between in vitro and in vivo AraQ analyses?

Contradiction: In vitro binding assays show AraQ-MsmX interaction requires 2 mM ATP, but in vivo activity occurs at physiological ATP concentrations (0.5–1 mM) .
Resolution:

  • Accessory proteins: In vivo, chaperones like GroEL stabilize the AraQ-MsmX complex .

  • Membrane potential: Proton motive force enhances substrate affinity in vivo, compensating for lower ATP levels .

  • Data reconciliation: Use B. subtilis membrane vesicles to replicate native lipid composition and electrochemical gradients .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.