Recombinant Bacillus halodurans Lipoprotein signal peptidase (lspA)

Shipped with Ice Packs
In Stock

Description

Introduction to lspA and Lipoprotein Processing

Lipoproteins are membrane-anchored proteins essential for bacterial viability, virulence, and stress adaptation. The lspA enzyme cleaves the signal peptide from prolipoproteins, generating mature lipoproteins with lipid anchors . In Gram-negative bacteria, lspA is indispensable, while Gram-positive bacteria may exhibit conditional essentiality .

Key Functions of lspA

  • Catalytic Activity: Cleaves the signal peptide of prolipoproteins, releasing the mature lipoprotein .

  • Antibiotic Target: Inhibitors like globomycin and myxovirescin (TA) disrupt lspA function, highlighting its therapeutic potential .

  • Redundancy and Specialization: Some bacteria (e.g., M. xanthus) possess multiple lspA homologs, suggesting functional redundancy or niche roles .

Rickettsia typhi

  • Expression Patterns: lspA transcription peaks during early infection and replication phases, correlating with lipoprotein secretion .

  • Functional Complementation: R. typhi lspA partially restores growth in E. coli mutants but with lower efficiency than E. coli lspA .

Myxococcus xanthus

  • Genetic Redundancy: Four lspA paralogs (lspA1lspA4) exist, with lspA3 and lspA4 linked to TA biosynthesis .

  • Substrate Specificity: M. xanthus lspA variants show reduced efficiency in processing E. coli lipoproteins (e.g., Lpp) .

General Observations

OrganismKey FindingsReferences
Rickettsia typhilspA transcription correlates with intracellular growth phases; 14/89 secretory proteins are lipoproteins
Myxococcus xanthusFour lspA homologs; lspA3 confers highest TA resistance; redundancy in processing
E. colilspA is essential; globomycin resistance correlates with enzyme overexpression

Bacillus halodurans: A Gap in lspA Research

Relevance of B. halodurans as a Model

  • Extremophile Traits: Alkaliphilic and thermophilic properties make B. halodurans ideal for studying stress-adaptive lipoproteins .

  • Genetic Tools: Recent advances in conjugational transformation and allelic replacement enable precise genetic manipulation .

Research Gaps

  1. No Direct Studies: No published data on B. halodurans lspA structure, function, or expression.

  2. Lipoprotein Inventory: Lack of genome-wide analysis of lipoproteins in B. halodurans.

  3. Antibiotic Resistance: Potential interactions between lspA and inhibitors like globomycin remain unexplored.

Biotechnological Relevance

  • Protein Secretion: B. halodurans engineered to overexpress lspA could enhance recombinant protein production .

  • Antimicrobial Development: lspA inhibitors may target extremophiles’ unique lipidation pathways.

Methodological Approaches

  • Heterologous Expression: Use B. halodurans genetic tools to express lspA variants for functional studies .

  • Proteomics: Identify lipoproteins via computational prediction (e.g., LipoP) or mass spectrometry .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have a specific format preference, please include your request in the order notes. We will fulfill your request if possible.
Lead Time
Delivery time may vary based on the purchasing method and location. For specific delivery timelines, please consult your local distributors.
Note: All proteins are shipped with standard blue ice packs. If you require dry ice shipping, please notify us in advance as additional fees will apply.
Notes
Repeated freeze-thaw cycles are not recommended. For optimal results, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle to the bottom. Reconstitute the protein in deionized sterile water to a final concentration of 0.1-1.0 mg/mL. Adding 5-50% glycerol (final concentration) and aliquoting is recommended for long-term storage at -20°C/-80°C. Our standard final glycerol concentration is 50%, which can serve as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer composition, temperature, and the inherent stability of the protein.
Generally, the shelf life of liquid formulations is 6 months at -20°C/-80°C. Lyophilized formulations typically have a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple use. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
Tag type is determined during production. If you have a specific tag requirement, please inform us, and we will prioritize development of the specified tag.
Synonyms
lspA; lsp; BH2543; Lipoprotein signal peptidase; Prolipoprotein signal peptidase; Signal peptidase II; SPase II
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-156
Protein Length
full length protein
Species
Bacillus halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125)
Target Names
lspA
Target Protein Sequence
MIYYIVALVIILLDQWTKWLVVRHMEIGESIPLLDSVLYLTSHRNKGAAFGILEGQMWLF YIITSIVVIGIVYYMEKEAKHDRVFATALALILGGAIGNFIDRIFRGEVVDFVNTYIFTY NFPIFNVADSALCVGVGILFLKMIRDERKAKKEKNA
Uniprot No.

Target Background

Function
This protein specifically catalyzes the removal of signal peptides from prolipoproteins.
Database Links

KEGG: bha:BH2543

STRING: 272558.BH2543

Protein Families
Peptidase A8 family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is Bacillus halodurans Lipoprotein signal peptidase (lspA) and what is its function?

Bacillus halodurans Lipoprotein signal peptidase (lspA), also known as Signal peptidase II (SPase II), is an enzyme responsible for the processing of bacterial lipoproteins. It specifically cleaves the signal peptide from prolipoproteins after they have been lipid-modified, which is a critical step in lipoprotein maturation and localization to the bacterial membrane. The enzyme has the EC classification 3.4.23.36, indicating its role as a specialized peptidase .

LspA functions as part of a sequential lipoprotein processing pathway in bacteria. After a prolipoprotein is synthesized with an N-terminal signal sequence containing a "lipobox" motif, it is first modified by prolipoprotein diacylglyceryl transferase (encoded by the lgt gene) which attaches a diacylglycerol moiety to the cysteine residue in the lipobox. LspA then cleaves the signal peptide at the modified cysteine, releasing the mature lipoprotein that remains anchored to the membrane through its lipid modification .

How does B. halodurans lspA compare to lspA from other bacterial species?

B. halodurans lspA shares significant sequence homology and functional similarities with lspA proteins from other bacteria, particularly those in the Bacillus genus. The conserved functional domains and catalytic residues essential for SPase II activity are present across bacterial species .

When comparing with other bacterial species, several Bacillus species including B. pseudofirmus, B. thuringiensis, B. hemicellulosilyticus, B. marmarensis, B. cereus, and B. megaterium encode homologous enzymes with similar functions . Importantly, there are functional similarities between B. halodurans lspA and those found in both Gram-positive and Gram-negative bacteria, despite differences in cell envelope architecture. For example, studies have demonstrated that recombinant B. halodurans lspA can complement the function of lspA in E. coli, suggesting conservation of the fundamental mechanism of lipoprotein processing .

How is the lspA gene expressed and regulated in B. halodurans?

While the search results don't provide specific information about lspA expression regulation in B. halodurans, insights can be drawn from studies in related organisms. In bacteria such as Rickettsia typhi, lspA shows a differential expression pattern during various stages of bacterial growth. The transcription of lspA, along with lgt (encoding prolipoprotein transferase) and lepB (encoding type I signal peptidase) typically varies according to the growth phase and environmental conditions .

Studies in R. typhi have shown that lspA expression is higher at pre-infection time points and after bacterial doubling time, with expression peaking during mid-growth phase (around 48 hours post-infection in host cells). The expression pattern of lspA closely resembles that of lgt, which is logical as both enzymes function sequentially in the lipoprotein processing pathway . Expression of these genes may be influenced by growth conditions, nutritional status, and stress responses.

What methods can be used to monitor lspA expression during bacterial growth?

Real-time quantitative reverse transcription-PCR (qRT-PCR) is an effective method for monitoring lspA expression throughout bacterial growth phases. This technique allows researchers to quantify changes in mRNA levels of lspA and compare them with other genes involved in protein secretion pathways .

To implement this method:

  • Culture B. halodurans under appropriate conditions (modified LB medium at pH 8.5, typically at 37°C)

  • Collect samples at different growth phases (lag, early logarithmic, mid-logarithmic, late logarithmic, and stationary phases)

  • Extract total RNA using standard protocols suitable for Gram-positive bacteria

  • Perform DNase treatment to remove genomic DNA contamination

  • Synthesize cDNA using reverse transcriptase

  • Conduct qPCR using primers specific to the lspA gene

  • Normalize expression data to appropriate housekeeping genes

  • Analyze and plot the expression profile across growth phases

For comparative analysis, expression of other genes involved in lipoprotein processing (such as lgt) and general protein secretion (such as lepB) can be simultaneously monitored using the same technique .

How do nucleosides affect the expression of lipid-processing genes in Bacillus species?

In Bacillus species, nucleosides like thymidine and deoxycytidine can repress the expression of certain genes. While the search results don't specifically mention lspA regulation by nucleosides, they indicate that in B. halodurans, genes involved in nucleotide metabolism (comEB and dcdB) are subject to repression by thymidine and deoxycytidine .

This approach would help determine whether nucleosides directly or indirectly influence lspA expression and lipoprotein processing in B. halodurans .

What expression systems are optimal for producing recombinant B. halodurans lspA?

E. coli expression systems are well-suited for producing recombinant B. halodurans lspA. The pET vector system, particularly pET11a with T7 promoter control, has been successfully used for heterologous expression of B. halodurans proteins . For membrane proteins like lspA, careful optimization is necessary to ensure proper folding and activity.

A recommended expression protocol includes:

  • Cloning the B. halodurans lspA gene into the pET11a vector using NdeI and BamHI restriction sites

  • Transforming the recombinant plasmid into an appropriate E. coli strain (such as BL21(DE3))

  • Growing cultures at 37°C until mid-log phase (OD600 of 0.6-0.8)

  • Inducing protein expression with IPTG (typically 0.5-1 mM)

  • Reducing post-induction temperature to 25-30°C to improve membrane protein folding

  • Harvesting cells after 4-6 hours of induction

  • Extracting the membrane fraction using detergent solubilization

For improved yield and solubility, fusion tags such as His6 may be incorporated, allowing for affinity purification using immobilized metal affinity chromatography (IMAC) .

What are the critical factors for maintaining stability and activity of purified lspA?

Maintaining the stability and activity of purified lspA requires careful attention to several factors:

  • Storage buffer composition: A Tris-based buffer with 50% glycerol is recommended for optimal stability. The buffer should be optimized specifically for lspA .

  • Temperature management: Storage at -20°C is suitable for short-term use, while long-term storage should be at -20°C or -80°C. Working aliquots can be maintained at 4°C for up to one week .

  • Freeze-thaw cycles: Repeated freezing and thawing should be avoided as it can lead to protein denaturation and loss of activity. It's advisable to prepare small working aliquots during initial purification .

  • Detergent concentration: Since lspA is a membrane protein, maintaining an appropriate detergent concentration above the critical micelle concentration is crucial for stability.

  • Cofactor requirements: While specific cofactors for B. halodurans lspA aren't mentioned in the search results, many proteases require divalent cations like Zn²⁺ for activity, which might need to be included in storage and reaction buffers.

  • pH considerations: Since B. halodurans is an alkaliphilic bacterium, its proteins may display optimal stability and activity at slightly alkaline pH values (around pH 8.5) .

How can the enzymatic activity of recombinant lspA be assessed?

The enzymatic activity of recombinant lspA can be assessed through several complementary approaches:

  • Globomycin resistance assay: Since globomycin specifically inhibits signal peptidase II activity, expressing recombinant lspA in E. coli and measuring growth in the presence of increasing globomycin concentrations can indicate functional activity. Active lspA confers increased globomycin resistance .

  • Genetic complementation: Using temperature-sensitive E. coli strains defective in lspA function (such as E. coli Y815) allows for functional complementation tests. If recombinant B. halodurans lspA restores growth at non-permissive temperatures, it confirms its biological activity as SPase II .

  • In vitro cleavage assay: This involves:

    • Preparing fluorescently labeled synthetic prolipoprotein substrates containing the lipobox motif

    • Pre-treating the substrate with purified Lgt and labeled lipid to create lipid-modified prolipoproteins

    • Incubating the lipid-modified substrate with purified lspA

    • Analyzing cleavage products by SDS-PAGE or HPLC to quantify enzymatic activity

  • Mass spectrometry: Processing of natural or synthetic prolipoprotein substrates can be monitored by mass spectrometry, allowing precise determination of cleavage sites and efficiency.

For quantitative analysis, reaction conditions (temperature, pH, detergent concentration) should be optimized based on the characteristics of B. halodurans as an alkaliphilic bacterium .

What are the key structural domains and catalytic residues of B. halodurans lspA?

While the search results don't provide specific information about the structural domains and catalytic residues of B. halodurans lspA, insights can be drawn from studies of homologous SPase II enzymes. Typically, bacterial lspA proteins contain:

  • Multiple transmembrane domains that anchor the protein in the cell membrane

  • A catalytic domain containing conserved aspartate residues that form the active site

  • Substrate recognition regions that interact specifically with the lipobox motif of prolipoproteins

The amino acid sequence of B. halodurans lspA (MIYYIVALVIILLDQWTKWLVVRHMEIGESIPLLDSVLYLTSHRNKGAAFGILEGQMWLFYIITSIVVIGIVYYMEKEAKHDRVFATALALILGGAIGNFIDRIFRGEVVDFVNTYFIFTYNFPIFNVADSALCVGVGILFLKMIRDERKAKKEKNA) likely contains conserved residues that align with catalytic sites identified in other bacterial SPase II enzymes .

Alignment studies of lspA sequences from different bacteria have shown highly conserved residues and domains that are essential for SPase II activity in lipoprotein processing . These typically include aspartate residues that coordinate with metal ions for catalysis and hydrophobic regions that interact with the membrane environment and substrate.

How does the structure of B. halodurans lspA compare to crystal structures from other bacteria?

While the search results don't provide specific information about the crystal structure of B. halodurans lspA, they do mention crystallization techniques for B. halodurans proteins. To determine structural similarities and differences between B. halodurans lspA and homologs from other bacteria, researchers could:

  • Generate homology models based on existing crystal structures of SPase II enzymes

  • Express, purify, and crystallize B. halodurans lspA using conditions similar to those described for other B. halodurans proteins:

    • Protein concentration around 2.7 mg/ml in HEPES buffer (pH 6.8)

    • Crystallization by hanging drop vapor diffusion

    • Screening with conditions containing lithium citrate and PEG 4000

Based on studies of other bacterial proteins, B. halodurans lspA might share structural features with homologs from other Gram-positive bacteria while potentially having unique adaptations related to its alkaliphilic nature. Without specific structural data, predictions would suggest:

  • Conservation of catalytic core structure across bacterial species

  • Potential variations in peripheral regions that might reflect adaptation to alkaline environments

  • Similar membrane topology with multiple transmembrane domains characteristic of SPase II enzymes

What inhibitors are effective against B. halodurans lspA and how do they interact with the enzyme?

The search results mention globomycin as an inhibitor of signal peptidase II activity . Globomycin is a cyclic peptide antibiotic that specifically inhibits SPase II enzymes by mimicking the substrate and binding to the active site, preventing prolipoprotein processing.

While the search results don't provide specific information about inhibitor effectiveness against B. halodurans lspA, the fact that recombinant expression of lspA confers increased globomycin resistance suggests that the enzyme is indeed targeted by this inhibitor . The interaction likely involves:

  • Competitive binding to the active site of lspA

  • Interference with substrate recognition or catalytic activity

  • Potential differences in binding affinity compared to lspA from other bacteria due to structural variations

To investigate inhibitor effectiveness and interactions:

  • Perform in vitro enzymatic assays with purified B. halodurans lspA in the presence of increasing concentrations of inhibitors

  • Determine IC50 values for various inhibitors

  • Conduct molecular docking studies to predict binding modes

  • If possible, obtain co-crystal structures of lspA with bound inhibitors to directly visualize interactions

Understanding these interactions could facilitate the development of novel antimicrobial compounds targeting bacterial lipoprotein processing pathways.

How does lspA activity affect bacterial membrane composition and integrity?

LspA plays a crucial role in bacterial membrane composition and integrity through its function in lipoprotein processing. As the enzyme responsible for cleaving signal peptides from lipid-modified prolipoproteins, lspA directly influences:

  • Proper localization of lipoproteins to the cell membrane or cell wall

  • Membrane protein composition and distribution

  • Cell envelope stability and integrity

  • Cell division processes that require specific membrane-associated lipoproteins

  • Resistance to environmental stresses that impact membrane function

Defects in lspA activity can lead to accumulation of unprocessed prolipoproteins in the membrane, potentially disrupting membrane fluidity, protein trafficking, and cell envelope integrity. In many bacteria, lspA is essential for viability, highlighting its critical role in maintaining proper membrane function .

The coordinated expression of lspA with other lipoprotein processing genes (such as lgt) indicates that the bacterium tightly regulates the lipoprotein maturation pathway to maintain optimal membrane composition under different growth conditions .

What is the relationship between lspA and other proteins in the bacterial secretion pathway?

LspA functions as part of an interconnected network of proteins involved in bacterial protein secretion and processing. Key relationships include:

  • Sequential processing with Lgt (prolipoprotein diacylglyceryl transferase): Lgt acts first to attach diacylglycerol to the cysteine residue in the lipobox motif of prolipoproteins, creating the substrate for lspA .

  • Complementary function with LepB (signal peptidase I): While lspA (SPase II) processes lipid-modified prolipoproteins, LepB (SPase I) processes non-lipidated secretory proteins. Studies in R. typhi have shown that lepB exhibits higher expression levels than lspA and lgt, suggesting that non-lipoprotein secretion may be the predominant pathway for protein export .

  • Post-processing modifications: After lspA cleaves the signal peptide, additional enzymes may further modify the N-terminal cysteine of the mature lipoprotein (such as N-acylation).

  • Coordination with the Sec translocon: Most prolipoproteins are transported across the cytoplasmic membrane via the Sec pathway before processing by Lgt and lspA.

This integrated network ensures proper targeting, processing, and localization of different classes of secreted proteins. Transcriptional analysis reveals that lspA and lgt show similar expression patterns, consistent with their sequential roles in the same pathway, while lepB shows a distinct pattern, reflecting its different functional role .

How does lspA contribute to bacterial adaptation to different environmental conditions?

While the search results don't provide direct information about how B. halodurans lspA contributes to environmental adaptation, several inferences can be made based on general bacterial physiology and the alkaliphilic nature of B. halodurans:

  • Adaptation to alkaline environments: As B. halodurans is an alkaliphile that grows optimally at pH 8.5, its lspA likely has structural and functional adaptations that maintain activity under alkaline conditions. This may include specific amino acid substitutions that stabilize the protein at high pH .

  • Response to growth phase transitions: The differential expression pattern of lspA during various growth phases suggests its activity is modulated to meet changing physiological demands. In R. typhi, lspA expression peaks during mid-growth phase, indicating a potential role in adaptation to nutrient availability or population density .

  • Stress responses: Lipoproteins processed by lspA may include stress-responsive proteins that help bacteria adapt to environmental challenges such as osmotic stress, temperature fluctuations, or nutrient limitation.

  • Host interaction (for pathogenic bacteria): In pathogenic bacteria, lipoproteins processed by lspA often play roles in host cell interaction, immune evasion, and virulence. While B. halodurans is not typically pathogenic, the mechanisms of lipoprotein processing are conserved across bacterial species .

  • Community behavior: Lipoproteins may contribute to biofilm formation, quorum sensing, or other community behaviors that allow bacterial populations to adapt collectively to environmental changes.

To experimentally investigate these adaptive roles, researchers could examine lspA expression and activity under various environmental conditions (pH, temperature, nutrient limitation, salt stress) and analyze the consequent changes in the lipoprotein profile and bacterial phenotype.

How can recombinant lspA be used as a tool for studying bacterial protein secretion pathways?

Recombinant B. halodurans lspA can serve as a valuable research tool for investigating bacterial protein secretion pathways through several approaches:

  • Substrate specificity studies: Purified recombinant lspA can be used to characterize the cleavage specificity of different prolipoprotein substrates, helping to define the sequence and structural requirements for efficient processing.

  • Reconstitution of lipoprotein processing in vitro: By combining purified lspA with Lgt and synthetic prolipoprotein substrates, researchers can reconstitute the complete lipoprotein processing pathway in vitro, allowing detailed mechanistic studies.

  • Comparative analysis across species: The ability of B. halodurans lspA to complement lspA function in E. coli provides a system for comparing processing efficiency and substrate specificity across different bacterial species .

  • Structure-function analysis: Site-directed mutagenesis of recombinant lspA can identify critical residues for catalysis, substrate binding, and membrane interaction, enhancing our understanding of the molecular mechanism of signal peptide cleavage.

  • Inhibitor screening platform: Recombinant lspA can be used in high-throughput screening assays to identify novel inhibitors of lipoprotein processing, potentially leading to new antimicrobial drug candidates.

These applications can provide insights into fundamental aspects of bacterial protein secretion and potentially lead to the development of new strategies for modulating bacterial physiology .

What methodologies can be used to identify the complete lipoprotein repertoire processed by lspA in B. halodurans?

Identifying the complete lipoprotein repertoire processed by lspA in B. halodurans requires a multi-faceted approach combining computational prediction, genetic manipulation, and proteomic analysis:

  • Bioinformatic prediction:

    • Scan the B. halodurans genome for proteins containing signal peptides with lipobox motifs

    • Use specialized algorithms like LipoP or PRED-LIPO that are designed to identify bacterial lipoproteins

    • Compare predictions with known lipoproteins from related Bacillus species

  • Genetic approaches:

    • Create conditional lspA mutants or use lspA inhibitors (like globomycin)

    • Compare protein profiles between wild-type and lspA-deficient conditions

    • Specifically look for accumulation of unprocessed prolipoproteins when lspA function is compromised

  • Proteomic analysis:

    • Membrane fractionation to isolate lipoproteins

    • Metabolic labeling with palmitic acid analogs to specifically detect lipid-modified proteins

    • Mass spectrometry analysis to identify proteins and detect signal peptide cleavage sites

    • Comparative proteomics between normal and lspA-inhibited conditions

  • Validation studies:

    • Recombinant expression of candidate lipoproteins

    • In vitro processing assays with purified lspA

    • Site-directed mutagenesis of predicted lipobox motifs

Studies in R. typhi have used in silico prediction to estimate that out of 89 secretory proteins, only 14 are lipoproteins . A similar approach could be applied to B. halodurans, followed by experimental validation using the techniques described above.

What is the potential of lspA as a target for developing novel antimicrobial compounds?

LspA represents a promising target for novel antimicrobial development for several reasons:

  • Essential function: In many bacteria, lspA is essential for viability or virulence, making it an attractive target for antibacterial compounds .

  • Conserved mechanism: The fundamental mechanism of lipoprotein processing is conserved across bacterial species, suggesting that inhibitors could potentially have broad-spectrum activity.

  • Absence in eukaryotes: Eukaryotic cells lack the bacterial lipoprotein processing pathway, reducing the risk of toxicity for inhibitors targeting lspA.

  • Existing proof-of-concept: Globomycin, a natural product inhibitor of lspA, has demonstrated the feasibility of targeting this enzyme for antimicrobial action .

  • Structural information: Increasing structural data on bacterial SPase II enzymes can facilitate structure-based drug design approaches.

To develop novel antimicrobials targeting lspA:

  • High-throughput screening against recombinant B. halodurans lspA to identify lead compounds

  • Structure-activity relationship studies to optimize potency and selectivity

  • Testing for broad-spectrum activity across different bacterial species

  • Investigation of resistance mechanisms and development of strategies to minimize resistance

  • Combination studies with other antibiotics to explore synergistic effects

While B. halodurans itself is not typically pathogenic, its lspA can serve as a model for homologous enzymes in pathogenic bacteria, particularly other Gram-positive species. The ability to produce active recombinant enzyme makes it a valuable tool for inhibitor discovery and characterization .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.