Recombinant Bacillus halodurans Membrane protein insertase YidC 2 (yidC2)

Shipped with Ice Packs
In Stock

Description

Definition and Production

Recombinant YidC2 is a full-length, His-tagged version of the native B. halodurans YidC2 protein (UniProt: Q9KDP2, residues 23–280), expressed in Escherichia coli . Key production details include:

ParameterSpecification
Expression SystemE. coli C43(DE3) cells
TagN-terminal His tag (cleavable via 3C protease)
Solubilization AgentCymal-6 detergent
PurificationTALON affinity + Superdex 200 gel filtration

This recombinant form retains the insertase activity of native YidC2, facilitating structural and functional studies .

Functional Mechanism

YidC2 operates via a Sec-independent insertase mechanism:

  • Electrostatic Recruitment: The hydrophilic groove attracts negatively charged N-terminal regions of substrate proteins (e.g., B. subtilis MifM) via Arg72 .

  • Hydrophobic Insertion: Subsequent interactions between substrate hydrophobic regions and membrane lipids drive transmembrane domain integration .

  • Chaperone Activity: Assists in folding Sec-translocated proteins, such as cytochrome c oxidase subunits .

Biochemical and Genetic Regulation

  • Regulatory Feedback: B. subtilis YidC2 expression is upregulated via the MifM sensor protein when primary insertase SpoIIIJ (YidC1) is deficient. MifM translational arrest exposes the yidC2 Shine-Dalgarno sequence, enabling compensatory expression .

  • Stabilization by C2 Loop: Molecular dynamics simulations show the unresolved cytoplasmic C2 loop stabilizes TM helices and interacts with lipid head groups, enhancing structural integrity .

Applications and Research Significance

  • Mechanistic Studies: Used to elucidate YidC family insertase mechanisms, particularly for single-spanning membrane proteins .

  • Structural Biology: Serves as a model for crystallizing membrane proteins in lipidic cubic phases .

  • Biotechnological Tool: Enables reconstitution assays to study membrane protein folding and integration .

Mutational and Functional Analysis

  • Critical Residues:

    • Arg72: Mutation to alanine abolishes insertase activity, confirming its role in substrate recruitment .

    • T362/Y517: Alanine substitutions in E. coli YidC homologs disrupt stability and function .

  • Deletion Studies: The hydrophilic periplasmic domain (HPD) is dispensable for viability but modulates conformational flexibility .

Comparative Analysis with Homologs

FeatureB. halodurans YidC2E. coli YidC
TM Helices56
Conserved ArgArg72Arg74
Substrate SpecificitySingle-spanning (e.g., MifM)Multi-spanning (e.g., LacY)
Structural Resolution2.4 Å (3WO7)3.8 Å (cryo-EM)

Future Directions

  • Dynamic Studies: Resolving conformational changes during substrate insertion using time-resolved crystallography.

  • Lipid Interactions: Elucidating roles of specific lipids in stabilizing YidC2’s unresolved loops .

  • Therapeutic Targeting: Exploring YidC2 as an antibiotic target due to its essential role in bacterial membrane biogenesis .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notification and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a reference.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us; we will prioritize its development.
Synonyms
yidC2; BH1169; Membrane protein insertase YidC 2; Foldase YidC 2; Membrane integrase YidC 2; Membrane protein YidC 2
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
23-280
Protein Length
Full Length of Mature Protein
Species
Bacillus halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125)
Target Names
yidC2
Target Protein Sequence
CSTTDPITSESEGIWNHFFVYPMSWLITTVANLLNGSYGLSIIIVTILIRLALLPLTLKQ QKSMRAMQVIRPEMEAIQKKYKEKGSKDPKVQQEMQKELLGLYQKHGVNPMAGCLPLFIQ LPILMAFYFAIMRTEEIRYHTFLWFDLGQPDYILPFVAGITTYFQFKMTMSHQQQMQKTN PSDSDNPMANMMQMQMKVMLYVMPVMIIIAGLSLPSALSLYWVIGNIFMIIQTYFIVVKA PPLEVEQTKQKSSKPNKA
Uniprot No.

Target Background

Function

Essential for the insertion, proper folding, and complex formation of integral membrane proteins within the cell membrane. It plays a role in the integration of membrane proteins, both those dependent and independent of the Sec translocase complex, as well as certain lipoproteins.

Database Links

KEGG: bha:BH1169

STRING: 272558.BH1169

Protein Families
OXA1/ALB3/YidC family, Type 2 subfamily
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.