Recombinant Bacillus halodurans Prolipoprotein diacylglyceryl transferase (lgt)

Shipped with Ice Packs
In Stock

Description

Introduction to Prolipoprotein Diacylglyceryl Transferase (Lgt)

Prolipoprotein diacylglyceryl transferase (Lgt) is an essential enzyme in bacterial lipid modification, catalyzing the transfer of a diacylglyceryl moiety from phosphatidylglycerol (PG) to the invariant cysteine residue in the lipobox motif of prolipoproteins (ppBLPs). This post-translational modification anchors lipoproteins to the bacterial membrane, enabling their functional roles in nutrient uptake, virulence, and cell envelope integrity . While extensively studied in Gram-negative and pathogenic Gram-positive bacteria like Escherichia coli and Listeria monocytogenes, Lgt in Bacillus halodurans (now classified as Halalkalibacterium halodurans) remains understudied despite its biotechnological potential.

Bacillus halodurans: A Model for Alkaliphilic Lgt Studies

Halalkalibacterium halodurans is a Gram-positive, alkaliphilic bacterium adapted to high-pH environments. Its genome encodes a single lgt homolog (BH0368), sharing structural and functional homology with Lgt enzymes in other species . Key characteristics include:

FeatureDescriptionReference
Genome OrganizationSingle lgt gene; no paralogs identified
Transmembrane DomainsPredicted 7 TMHs, consistent with Lgt topology in E. coli and B. subtilis
Catalytic MotifConserved His-Gly-Gly-Leu sequence critical for diacylglyceryl transfer

Genetic Manipulation of Halalkalibacterium halodurans for Lgt Studies

Recent advances in genetic tools enable precise engineering of H. halodurans:

MethodApplicationEfficiency
Allelic ReplacementGene deletion/mutation via pBASE_Bha plasmid; no marker retentionHigh
Plasmid MethylationIn vitro methylation for strain-specific transformationRapid (8 days)
Counter-SelectionsecY antisense RNA for plasmid curingEffective

These methods facilitate:

  • Gene Knockouts: Deletion of lgt to study lipoprotein secretion.

  • Site-Directed Mutagenesis: Introduction of catalytic residue mutations (e.g., His→Asn).

  • Complementation: Expression of wild-type or heterologous lgt in Δlgt mutants .

Research Gaps and Future Directions

Critical areas for investigation include:

  1. Biochemical Characterization: Kinetic analysis of H. halodurans Lgt using PG substrates.

  2. Lipoprotein Substrate Specificity: Identification of H. halodurans lipoproteins requiring Lgt.

  3. Industrial Strain Optimization: Engineering lgt to enhance secretion of recombinant proteins .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please consult your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a guideline.
Shelf Life
Shelf life depends on storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. To request a specific tag, please inform us, and we will prioritize its development.
Synonyms
lgt; BH3589; Phosphatidylglycerol--prolipoprotein diacylglyceryl transferase
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-289
Protein Length
full length protein
Species
Bacillus halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125)
Target Names
lgt
Target Protein Sequence
MEEMIEPLDRVFLQLGPFTIYWYGVLIGLGVIIGYVMASRESVRRGMPKDTFSDFVMYVI PVAIIFARLYYVIFRWEQYADDPIRVFYIWEGGLAIHGALIGGVLTAYILTKKRQLSFWQ LMDVAAPSILIGQAIGRWGNFMNQEVYGGPVTREFLEGLMLPEFIINQMYINGTYYHPTF LYESIWNFIGVVVLLLLRRVNLRRGELFFSYLIWYSIGRFFIEGMRLDNLMIGDSLRTAQ IVSILLIVGALLLWWYRRAKGLATERYLDPHQPARTNGNKKKTKKKKKK
Uniprot No.

Target Background

Function

Function: Recombinant Bacillus halodurans Prolipoprotein diacylglyceryl transferase (Lgt) catalyzes the transfer of the diacylglyceryl group from phosphatidylglycerol to the sulfhydryl group of the N-terminal cysteine of a prolipoprotein. This is the initial step in mature lipoprotein formation.

Database Links

KEGG: bha:BH3589

STRING: 272558.BH3589

Protein Families
Lgt family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is prolipoprotein diacylglyceryl transferase (lgt) and what is its function in bacteria?

Prolipoprotein diacylglyceryl transferase (lgt) is a key enzyme in bacterial lipoprotein biosynthesis that catalyzes the transfer of a diacylglyceryl moiety to the N-terminal cysteine residue of prolipoproteins. This modification is essential for proper anchoring of lipoproteins to the bacterial membrane. In bacteria like Listeria monocytogenes, lgt plays a critical role in lipoprotein retention and translocation . The enzyme functions as part of a sequential processing pathway for bacterial lipoproteins, where it performs the initial lipidation step before further processing by other enzymes.

The lgt enzyme is essential in all Gram-negative bacteria, with mutations in the lgt gene being lethal in Escherichia coli and related species . This essentiality has been leveraged to develop novel selection systems for recombinant protein expression, as bacteria cannot survive without a functional lgt gene, making it a powerful tool for maintaining plasmid stability without antibiotics.

How does lgt from Bacillus halodurans compare structurally to lgt from other bacterial species?

Unlike lgt from Gram-negative bacteria like E. coli, where the gene is essential, lgt deletion in some Gram-positive bacteria such as Listeria monocytogenes is viable though it affects lipoprotein processing . B. halodurans, being an alkaliphilic Gram-positive bacterium, likely has an lgt protein with adaptations for function in alkaline conditions, similar to other enzymes from this organism that demonstrate activity at elevated pH levels.

The structural comparison of lgt proteins across bacterial species reveals domain conservation related to membrane association and substrate recognition, though species-specific variations exist particularly in regions that interact with diverse prolipoproteins.

What are the optimal conditions for expressing recombinant lgt from B. halodurans in heterologous systems?

Based on successful expression protocols for other B. halodurans proteins and general principles for recombinant enzyme expression, the following conditions are recommended:

Culture conditions:

  • Temperature: 37°C for growth, with potential reduction to 30°C after induction to enhance proper folding

  • pH: 7.2-8.0 during growth phase, potentially higher (pH 8-9) for B. halodurans proteins which are naturally adapted to alkaline conditions

  • Medium: Rich media like LB or Superbroth for high cell density

  • Induction: IPTG at final concentration of 1 mM when OD600 reaches 0.6-0.8

Expression system recommendations:

  • Host: E. coli BL21(DE3) or similar expression strains

  • Vectors: Those containing T7 or tac promoters for controlled expression

  • Tags: N-terminal His-tag for simplified purification without affecting the critical C-terminal region of lgt

For optimal results with membrane proteins like lgt, additional considerations include:

  • Slower induction at lower temperatures (16-25°C)

  • Addition of membrane-stabilizing compounds

  • Possible co-expression with chaperones to enhance proper folding

Successful expression can be verified through SDS-PAGE analysis followed by Western blotting using anti-His antibodies if a His-tag is incorporated in the recombinant construct.

How can I establish an lgt-based selection system in B. halodurans for stable plasmid maintenance without antibiotics?

Establishing an lgt-based selection system in B. halodurans requires a multi-step approach similar to the one developed for E. coli and V. cholerae :

Step 1: Genome modification

  • Create a clean deletion of the chromosomal lgt gene in B. halodurans using a temperature-sensitive complementation approach:

    • First, introduce a temperature-sensitive plasmid carrying an lgt gene from another species (e.g., E. coli or V. cholerae lgt)

    • Delete the native lgt gene via homologous recombination

    • Verify deletion through PCR with primers flanking the lgt gene

Step 2: Construct expression vectors

  • Design a temperature-insensitive expression vector containing:

    • The complementing lgt gene from another species

    • Your gene of interest under control of an appropriate promoter

    • Required origins of replication for B. halodurans

Step 3: Transformation and selection

  • Transform the expression vector into the lgt-deleted B. halodurans strain

  • Select transformants by their ability to grow at non-permissive temperature (e.g., 39°C) which eliminates cells without the complementing lgt gene

  • Verify plasmid presence through colony PCR targeting unique plasmid sequences

Step 4: Optimization and verification

  • Assess plasmid stability by conducting sequential passages without selection and quantifying plasmid retention

  • Compare protein expression levels with conventional antibiotic-based systems

  • Measure growth rates to ensure the complementation doesn't significantly impair bacterial fitness

This system leverages the essentiality of lgt to maintain vector stability without antibiotics, making it particularly valuable for large-scale production of recombinant proteins where antibiotic use is undesirable .

What methodologies can be used to assay lgt enzymatic activity in vitro?

To assess the enzymatic activity of recombinant B. halodurans lgt in vitro, researchers can employ several complementary approaches:

1. Radioactive lipid incorporation assay:

  • Incubate purified lgt with radiolabeled phospholipids (typically [³H]-labeled or [¹⁴C]-labeled diacylglycerol) and synthetic prolipoprotein peptide substrates

  • After reaction, separate the products using thin-layer chromatography

  • Quantify radioactivity incorporation into peptide substrates using scintillation counting

  • Calculate enzyme activity based on the amount of radiolabeled lipid transferred to the peptide

2. FRET-based activity assay:

  • Design fluorescently labeled synthetic peptide substrates containing a FRET pair

  • Monitor conformational changes upon lipidation through changes in FRET efficiency

  • This allows real-time kinetic measurements in a high-throughput format

3. Mass spectrometry-based assay:

  • React purified lgt with synthetic peptide substrates and phospholipid donors

  • Analyze reaction products by LC-MS/MS to detect mass shifts corresponding to diacylglycerol addition

  • Quantify modified and unmodified peptides to determine reaction efficiency

Reaction conditions for activity assays:

ParameterOptimum rangeNotes
pH7.5-9.0For B. halodurans enzymes, higher pH values may be optimal
Temperature37-60°CB. halodurans enzymes often show thermostability
Divalent cations5-10 mM Mg²⁺Essential cofactor for activity
Detergent0.1-1% DDM or Triton X-100Critical for solubilizing the membrane-associated enzyme
Reducing agent1-5 mM DTTTo maintain cysteine residues in reduced state

Activity should be reported as specific activity (μmol of substrate converted per minute per mg of enzyme) under standardized conditions.

How can I perform site-directed mutagenesis to identify critical residues in B. halodurans lgt?

A systematic approach to identifying critical residues in B. halodurans lgt through site-directed mutagenesis involves:

1. In silico analysis and target selection:

  • Perform multiple sequence alignment with lgt proteins from diverse bacterial species

  • Identify conserved residues as potential catalytic or structural determinants

  • Use homology modeling to predict the 3D structure based on crystallized lgt proteins

  • Select residues for mutagenesis prioritizing those in predicted active sites, binding pockets, or membrane interfaces

2. Mutagenesis strategy:

  • Design primers containing desired mutations following standard site-directed mutagenesis principles:

    • 25-45 bp in length with the mutation centered

    • Tm ≥78°C

    • GC content >40%

    • Terminate in G or C bases

  • Perform PCR-based mutagenesis using high-fidelity polymerase

  • Digest template DNA with DpnI to selectively remove methylated parental DNA

  • Transform into E. coli for plasmid amplification and verify mutations by sequencing

3. Functional characterization of mutants:

4. Data analysis and interpretation:

  • Calculate relative activity of each mutant compared to wild-type enzyme

  • Classify mutations based on effect: catalytic (affecting kcat), binding (affecting Km), structural (affecting stability)

  • Map mutations onto structural model to identify functional domains

  • For thermostable enzymes like those from B. halodurans, include thermal stability assessments of mutants

This systematic approach allows for comprehensive understanding of structure-function relationships in lgt enzymes and can reveal species-specific features of B. halodurans lgt compared to homologs from other bacteria.

What are the optimal conditions for large-scale production of B. halodurans lgt in bioreactors?

Large-scale production of B. halodurans lgt in bioreactors requires careful optimization of multiple parameters:

Bioreactor setup and growth conditions:

  • Medium: Superbroth (SB) provides superior yields compared to standard LB medium

  • Temperature: 37°C for growth phase

  • pH: 7.2, maintained through automated addition of 4M HCl or 6.25M NaOH

  • Aeration: 4 liters/min for a 3-liter culture volume

  • Agitation: 600 rpm

  • Foam control: 30% aqueous solution of Antifoam 204

  • Induction: IPTG at 1 mM when OD600 reaches 0.6

  • Harvest time: 18-22 hours post-induction

Expression system optimization:

  • For highest yields, an lgt-based selection system can be employed instead of antibiotic resistance

  • This system shows comparable protein yields to conventional antibiotic-based systems while eliminating concerns about antibiotic residues

Scale-up considerations:
The process has been successfully scaled from 3-liter to 500-liter fermentations for similar recombinant proteins, suggesting feasibility for industrial-scale production of lgt . Key considerations during scale-up include:

  • Maintaining adequate oxygen transfer rates

  • Ensuring uniform mixing

  • Controlling heat generation

  • Implementing feed strategies for extended high-density cultivation

Monitoring parameters during production:

ParameterMeasurement frequencyTarget range
pHContinuous7.0-7.5
Dissolved oxygenContinuous>30% saturation
TemperatureContinuous37±0.5°C
Cell density (OD600)Every 2-4 hoursTrack growth curve
Glucose levelEvery 4 hours>5 g/L
Protein expressionPre/post inductionVerify by SDS-PAGE

The fermentation protocol should be optimized specifically for lgt expression, as this membrane-associated enzyme may require modifications to standard protocols used for soluble proteins.

What purification strategies yield the highest purity and activity of recombinant B. halodurans lgt?

Purification of membrane-associated proteins like lgt requires specialized approaches to maintain structural integrity and enzymatic activity:

Step 1: Membrane extraction and solubilization

  • Harvest cells through centrifugation (6,000×g, 15 min, 4°C)

  • Resuspend in buffer containing 50 mM Tris-HCl pH 8.0, 150 mM NaCl, 10% glycerol

  • Disrupt cells via sonication or high-pressure homogenization

  • Remove unbroken cells and debris by centrifugation (10,000×g, 20 min, 4°C)

  • Isolate membranes by ultracentrifugation (100,000×g, 1 h, 4°C)

  • Solubilize membrane proteins with 1% n-dodecyl-β-D-maltoside (DDM) or other appropriate detergent in buffer containing 50 mM Tris-HCl pH 8.0, 300 mM NaCl, 10% glycerol, and 5 mM imidazole for His-tagged proteins

Step 2: Affinity chromatography

  • Apply solubilized protein to Ni-NTA resin equilibrated with solubilization buffer containing 0.05% DDM

  • Wash extensively with buffer containing 20-30 mM imidazole

  • Elute with step gradient of imidazole (100-300 mM)

  • Analyze fractions by SDS-PAGE and pool peak fractions

Step 3: Size exclusion chromatography

  • Concentrate pooled fractions using 50 kDa MWCO centrifugal filters

  • Apply to Superdex 200 column equilibrated with 50 mM Tris-HCl pH 8.0, 150 mM NaCl, 10% glycerol, 0.03% DDM

  • Collect fractions and analyze by SDS-PAGE

  • Pool fractions containing pure lgt

Step 4: Quality assessment

  • Determine protein concentration using BCA assay (avoiding Bradford due to detergent interference)

  • Verify purity by SDS-PAGE (>95%)

  • Confirm identity by Western blot and/or mass spectrometry

  • Assess enzymatic activity using established assays

  • Evaluate oligomeric state by native PAGE or analytical ultracentrifugation

Purification yields and optimization:
Typical yields of 2-5 mg of purified lgt per liter of culture can be expected. Higher yields may be achievable through optimization of:

  • Detergent type and concentration

  • Buffer composition and pH

  • Salt concentration

  • Addition of stabilizing agents (glycerol, specific lipids)

The purified enzyme should be stored with stabilizing agents (glycerol, specific phospholipids) at -80°C to maintain activity for extended periods.

How can I troubleshoot low expression levels of recombinant B. halodurans lgt in E. coli?

Low expression levels of B. halodurans lgt in E. coli may stem from multiple factors. The following systematic troubleshooting approach addresses common issues:

1. Codon optimization issues:

  • Problem: B. halodurans has different codon usage patterns than E. coli

  • Solution: Synthesize a codon-optimized gene version for E. coli

  • Verification: Compare expression levels between native and optimized sequences

2. Toxicity of overexpressed lgt:

  • Problem: Membrane protein overexpression can disrupt host cell membrane integrity

  • Solutions:

    • Use tightly regulated promoters (T7lac, araBAD)

    • Reduce induction levels (0.1-0.5 mM IPTG instead of 1 mM)

    • Lower cultivation temperature after induction (16-25°C)

    • Use C41(DE3) or C43(DE3) E. coli strains designed for toxic membrane proteins

  • Verification: Monitor growth curves post-induction to detect growth inhibition

3. Protein misfolding and degradation:

  • Problem: Improper folding leading to degradation by host proteases

  • Solutions:

    • Co-express with chaperones (GroEL/GroES, DnaK/DnaJ)

    • Use E. coli strains deficient in specific proteases

    • Add stabilizing agents to growth medium (glycerol, specific phospholipids)

    • Fuse with solubility-enhancing partners (MBP, SUMO)

  • Verification: Western blot analysis to detect degradation products

4. Experimental optimization table:

ParameterTest rangeOptimal condition indicators
Induction OD6000.4-1.0Higher cell density before toxicity onset
IPTG concentration0.1-1.0 mMBalance between expression and toxicity
Post-induction temperature16-37°CSlower expression, better folding at lower temperatures
Post-induction time3-24 hoursMaximum accumulation before degradation
Media compositionLB, TB, 2xYT, M9Nutrient availability impact on expression

5. Expression construct design considerations:

  • Test multiple affinity tags (His, FLAG, Strep) at both N- and C-termini

  • Consider fusion proteins that can be later cleaved with specific proteases

  • Verify sequence integrity to rule out mutations affecting expression

  • Test different signal sequences if secretion is desired

6. Host strain selection:

  • Compare expression in BL21(DE3), Rosetta(DE3), C41(DE3), C43(DE3), and SHuffle

  • Consider using a strain with an oxidizing cytoplasm for proper disulfide bond formation if relevant

Each modification should be tested systematically, changing only one parameter at a time to identify the specific factors limiting expression.

How can I utilize B. halodurans lgt to develop an antibiotic-free selection system for recombinant protein production?

Developing an antibiotic-free selection system based on B. halodurans lgt follows these key steps:

1. Construct design and generation:

  • Engineer a recipient strain with chromosomal lgt deletion complemented by a temperature-sensitive plasmid:

    • Delete the native lgt gene

    • Provide the lgt gene on a temperature-sensitive plasmid that replicates at 30°C but not at 39°C

    • Verify temperature-dependent growth phenotype

  • Design expression vectors containing:

    • B. halodurans lgt gene as a selection marker

    • Multiple cloning site for target gene insertion

    • Promoter and terminator sequences appropriate for the expression host

    • Origin of replication compatible with the host

2. Transformation and selection protocol:

  • Transform expression vector into the lgt-deleted strain

  • Select transformants by growth at non-permissive temperature (39°C)

  • Verify plasmid presence through colony PCR

  • Test plasmid stability through serial passages without selection

3. Expression optimization:

  • Adjust induction parameters (timing, concentration, temperature)

  • Optimize media composition for highest yield

  • Determine optimal harvest time

4. System performance evaluation:
The lgt-based selection system offers significant advantages:

  • Plasmids show extreme stability without antibiotics

  • Protein expression levels are comparable to antibiotic-selected systems

  • The approach eliminates antibiotic residues in final products

  • The method reduces environmental release of antibiotics and resistance genes

  • Scale-up to industrial production is feasible (demonstrated for similar systems)

5. Adaptation for diverse bacterial hosts:
Since lgt is essential in all Gram-negative bacteria, this selection strategy can be extended to other bacterial species, making it a versatile platform for various expression systems .

Comparative performance data:

ParameterAntibiotic selectionlgt-based selection
Plasmid stabilityRequires continuous selectionMaintained without selection
Protein yieldStandardComparable to standard
Media requirementsAntibiotic supplementationStandard media only
Scale-up considerationsAntibiotic costs, residuesNo antibiotic concerns
Environmental impactRelease of antibiotics and resistance genesMinimal environmental concern

This system is particularly valuable for pharmaceutical-grade protein production where antibiotic residues are undesirable.

How does temperature and pH affect the stability and activity of B. halodurans lgt?

As an enzyme from an alkaliphilic and moderately thermophilic bacterium, B. halodurans lgt is expected to demonstrate distinct temperature and pH stability profiles compared to homologs from mesophilic bacteria:

Temperature effects:
Based on data from other characterized B. halodurans enzymes (such as the beta-glucanase), the recombinant lgt would likely show:

  • Temperature optimum around 50-60°C

  • Retention of 100% activity after 2-hour incubation at 50°C

  • Approximately 50% activity retention after 2-hour incubation at 60°C

  • Complete inactivation after 30-minute exposure to 70°C

This thermostability profile is characteristic of enzymes from B. halodurans and represents an adaptation to the organism's natural habitat.

pH stability and activity profile:
B. halodurans enzymes typically show:

  • pH optimum in the alkaline range (pH 8-10)

  • Broader pH stability range than mesophilic counterparts

  • Retention of structural integrity at alkaline pH

  • Specialized ionic interactions that maintain protein folding at high pH

Experimental characterization methodology:
To precisely determine these parameters for B. halodurans lgt:

  • Temperature optimization:

    • Measure enzyme activity at temperatures ranging from 30-70°C in 5°C increments

    • Determine the temperature providing maximum activity (Topt)

  • Thermal stability assessment:

    • Pre-incubate enzyme at various temperatures (30-80°C) for defined time periods (15, 30, 60, 120 min)

    • Measure residual activity at standard conditions

    • Calculate half-life (t1/2) at each temperature

  • pH optimization:

    • Measure enzyme activity across pH range 5-11 using appropriate buffer systems

    • Determine pH providing maximum activity (pHopt)

  • pH stability assessment:

    • Pre-incubate enzyme at various pH values for defined time periods

    • Measure residual activity at standard conditions

    • Determine pH stability range

Stabilization strategies:

  • Addition of compatible solutes (trehalose, glycerol)

  • Inclusion of specific ions (Ca²⁺, Mg²⁺)

  • Addition of reducing agents to prevent oxidation of cysteine residues

  • Protein engineering to enhance stability while maintaining activity

Understanding these parameters is essential for optimizing expression, purification, and application conditions for recombinant B. halodurans lgt.

What techniques can be used to study the interaction between lgt and its substrates?

Investigating the interactions between B. halodurans lgt and its substrates requires advanced biophysical and biochemical techniques:

1. Binding affinity determination:

  • Isothermal Titration Calorimetry (ITC):

    • Directly measures thermodynamic parameters (ΔH, ΔS, ΔG) and binding constants (Kd)

    • Requires purified lgt and synthetic peptide substrates

    • Provides stoichiometry information

    • Data interpretation must account for detergent micelles in the system

  • Surface Plasmon Resonance (SPR):

    • Measures real-time binding kinetics (kon, koff)

    • Requires immobilization of either lgt or substrate on sensor chip

    • Allows determination of binding constants under various conditions

    • Enables rapid screening of multiple substrate variants

2. Structural studies:

  • X-ray Crystallography:

    • Provides atomic-level details of enzyme-substrate interactions

    • Challenges include obtaining crystals of membrane proteins

    • Consider lipidic cubic phase crystallization approaches

    • Co-crystallization with substrate analogs or transition state mimics

  • Cryo-Electron Microscopy:

    • Increasingly powerful for membrane protein structural determination

    • May reveal conformational changes upon substrate binding

    • Sample preparation in nanodiscs or amphipols can preserve native-like environment

  • Nuclear Magnetic Resonance (NMR):

    • Useful for identifying binding interfaces

    • Chemical shift perturbation experiments identify residues involved in substrate binding

    • Solution NMR challenging for full-length lgt but feasible for soluble domains

3. Functional analysis techniques:

  • Enzyme kinetics:

    • Determine Km, kcat, and substrate specificity

    • Compare natural substrates with synthetic variants

    • Assess competitive inhibition patterns

  • Photo-crosslinking:

    • Incorporate photo-activatable groups into substrate analogs

    • UV irradiation creates covalent bonds at interaction sites

    • MS analysis identifies crosslinked residues

  • Hydrogen-deuterium exchange mass spectrometry (HDX-MS):

    • Maps regions of lgt that undergo conformational changes upon substrate binding

    • Identifies protected regions indicating binding interfaces

    • Compatible with membrane proteins in detergent solutions

4. Computational approaches:

  • Molecular docking:

    • Predicts binding modes of substrates to lgt

    • Requires homology model if crystal structure unavailable

    • Validates experimental findings

  • Molecular dynamics simulations:

    • Examines dynamic interactions between lgt and substrates

    • Provides insights into conformational changes during catalysis

    • Special considerations needed for membrane environment simulation

These complementary approaches provide comprehensive understanding of how B. halodurans lgt recognizes and processes its substrates, which is essential for enzyme engineering and inhibitor design applications.

What strategies can address inconsistent activity of purified recombinant B. halodurans lgt?

Inconsistent activity of purified recombinant B. halodurans lgt can result from multiple factors. Here's a systematic approach to identify and resolve these issues:

1. Protein quality factors:

  • Oxidation of critical cysteine residues:

    • Problem: Cysteine oxidation can inactivate enzymes

    • Solution: Add reducing agents (DTT, β-mercaptoethanol) to all buffers

    • Verification: Compare activity with and without reducing agents

  • Protein aggregation:

    • Problem: Formation of inactive aggregates during purification or storage

    • Solutions:

      • Optimize detergent type and concentration

      • Include stabilizing agents (glycerol, specific lipids)

      • Perform size exclusion chromatography as final purification step

    • Verification: Dynamic light scattering to assess homogeneity

  • Loss of essential cofactors:

    • Problem: Removal of required metal ions or lipids during purification

    • Solution: Supplement assay buffer with potential cofactors (Mg²⁺, Ca²⁺, Zn²⁺, phospholipids)

    • Verification: Activity restoration upon cofactor addition

2. Assay condition optimization:

ParameterTest rangeOptimization approach
pH7.0-10.00.5 pH unit increments
Temperature30-65°C5°C increments
Ionic strength50-500 mM NaCl50 mM increments
Detergent0.01-0.1% various detergentsType and concentration matrix
Divalent cations1-10 mM Mg²⁺, Ca²⁺, Mn²⁺Individual and combinations

3. Storage stability issues:

  • Freeze-thaw degradation:

    • Problem: Activity loss during freeze-thaw cycles

    • Solutions:

      • Prepare single-use aliquots

      • Add cryoprotectants (20% glycerol, trehalose)

      • Store at -80°C rather than -20°C

    • Verification: Activity comparison before/after freeze-thaw cycles

  • Time-dependent inactivation:

    • Problem: Gradual activity loss during storage

    • Solution: Test addition of stabilizers (specific phospholipids, cholesterol)

    • Verification: Monitor activity over time under different storage conditions

4. Substrate preparation issues:

  • Substrate variability:

    • Problem: Variation in substrate quality between batches

    • Solution: Standardize substrate preparation protocols

    • Verification: Include internal controls with each assay

  • Substrate solubility:

    • Problem: Poor dispersion of lipid substrates

    • Solutions:

      • Optimize sonication or extrusion protocols

      • Test different substrate presentation methods (liposomes, micelles)

    • Verification: Microscopy to assess substrate homogeneity

5. Systematic troubleshooting approach:

  • Establish baseline activity with fresh enzyme preparation

  • Test one variable at a time to identify critical factors

  • Create standard operating procedure (SOP) incorporating all optimized parameters

  • Implement quality control checks at each step of purification and storage

  • Include positive controls in each activity assay

By methodically addressing these potential issues, researchers can achieve consistent and reproducible activity measurements for recombinant B. halodurans lgt.

How can I overcome challenges in expressing functional B. halodurans lgt in different host systems?

Successfully expressing functional B. halodurans lgt in various host systems requires addressing challenges specific to each expression platform:

1. E. coli expression system challenges:

  • Challenge: Improper membrane insertion

    • Strategy: Use specialized E. coli strains (C41/C43) designed for membrane protein expression

    • Implementation: Compare protein localization and activity across multiple strains

  • Challenge: Protein aggregation in inclusion bodies

    • Strategies:

      • Lower temperature after induction (16-25°C)

      • Reduce inducer concentration

      • Use solubility-enhancing fusion partners (MBP, SUMO, TrxA)

    • Implementation: Optimize induction parameters through factorial design experiments

  • Challenge: Improper disulfide bond formation

    • Strategy: Express in SHuffle strains with oxidizing cytoplasm

    • Implementation: Compare activity between standard and redox-engineered strains

2. Yeast expression system approaches:

  • Challenge: Hyperglycosylation affecting activity

    • Strategies:

      • Use glycosylation-deficient strains

      • Mutate potential N-glycosylation sites (N-X-S/T)

    • Implementation: Compare wild-type and mutated constructs via Western blot and activity assays

  • Challenge: Different membrane composition

    • Strategy: Supplement growth media with specific phospholipids

    • Implementation: Analyze membrane composition and correlate with enzyme activity

3. Baculovirus/insect cell system considerations:

  • Challenge: Low expression levels

    • Strategies:

      • Optimize codon usage for insect cells

      • Test different promoters (polyhedrin vs. p10)

      • Optimize MOI and harvest time

    • Implementation: Time-course analysis of expression levels

  • Challenge: Incomplete post-translational processing

    • Strategy: Verify signal peptide cleavage and membrane targeting

    • Implementation: N-terminal sequencing and membrane fractionation

4. Cell-free expression systems:

  • Challenge: Providing membrane environment

    • Strategies:

      • Include nanodiscs or liposomes in reaction

      • Use detergent-based systems

    • Implementation: Compare protein folding and activity in different membrane mimetics

5. Comparative expression strategy table:

Host systemAdvantagesChallengesOptimization strategies
E. coliFast growth, high yieldsMay form inclusion bodiesLower temperature, specialized strains
YeastEukaryotic processingHyperglycosylationGlycosylation-deficient strains
Insect cellsComplex folding capacitySlower, more expensiveOptimize MOI, harvest time
Cell-freeRapid screeningRequires membrane mimeticsInclude nanodiscs or liposomes
B. subtilisGram-positive native environmentDifferent secretion mechanismsOptimize signal sequences

6. Key considerations for alkaliphilic protein expression:

Since B. halodurans is an alkaliphilic organism, its proteins may have evolved specific features for function at high pH. Consider:

  • Testing expression at elevated pH where possible

  • Evaluating protein stability and activity across broader pH ranges

  • Assessing the impact of ionic strength on proper folding

By systematically addressing these system-specific challenges, researchers can identify the optimal expression platform for producing functional B. halodurans lgt for their specific research applications.

What are common pitfalls in designing experiments to study the role of lgt in bacterial lipoprotein processing?

Researching lgt function in bacterial lipoprotein processing involves numerous experimental challenges. Here are key pitfalls and strategies to address them:

1. Genetic manipulation challenges:

  • Pitfall: Lethal effects of lgt deletion in many bacteria

    • Solution: Use conditional knockout strategies such as:

      • Temperature-sensitive complementation plasmids

      • Inducible expression systems (Tet-on/off)

      • Degron-based protein depletion systems

    • Implementation: Verify complete depletion using Western blot before phenotypic analysis

  • Pitfall: Polar effects on downstream genes

    • Solution: Use precise in-frame deletion methods or CRISPR/Cas9

    • Implementation: Verify transcription of adjacent genes after genetic manipulation

2. Substrate specificity determination issues:

  • Pitfall: Artificial substrates may not reflect in vivo specificity

    • Solution: Validate findings with multiple approaches:

      • In vitro biochemical assays with purified components

      • In vivo pulse-chase experiments

      • Global lipoproteomic analysis

    • Implementation: Compare results across methodologies to identify consistent patterns

  • Pitfall: Missing low-abundance lipoproteins in analyses

    • Solutions:

      • Enrich lipoproteins using detergent extraction

      • Apply targeted mass spectrometry approaches

      • Use metabolic labeling with azide-modified fatty acids

    • Implementation: Compare standard vs. enrichment protocols

3. Data interpretation challenges:

  • Pitfall: Misattributing indirect effects to lgt function

    • Solution: Include appropriate controls:

      • Complementation experiments

      • Catalytically inactive lgt mutants

      • Time-course analyses after lgt depletion

    • Implementation: Distinguish primary from secondary effects through temporal analysis

  • Pitfall: Overlooking compensatory mechanisms

    • Solution: Perform transcriptomic/proteomic analyses to identify upregulated pathways

    • Implementation: Compare acute vs. long-term effects of lgt depletion

4. Technical considerations for lipoprotein analysis:

  • Pitfall: Inadequate separation of lipidated vs. non-lipidated forms

    • Solutions:

      • Use Tricine-SDS-PAGE for better resolution of small mobility differences

      • Apply metabolic labeling with radioactive precursors

      • Develop MS methods to directly detect lipidation

    • Implementation: Compare multiple detection methods

  • Pitfall: Cross-contamination during subcellular fractionation

    • Solutions:

      • Validate fractionation quality with established markers

      • Use density gradient centrifugation for cleaner separation

      • Apply proteolytic shaving techniques to distinguish surface-exposed proteins

    • Implementation: Quantify contamination levels in each fraction

5. Comparative analysis across species:

  • Pitfall: Assuming conserved substrate specificity across bacterial species

    • Solution: Perform side-by-side comparison of lgt homologs from different species

    • Implementation: Express heterologous lgt genes in a common host background

  • Pitfall: Overlooking differences between in vitro and in vivo conditions

    • Solution: Develop cell-based assays that better recapitulate natural environments

    • Implementation: Compare results between reconstituted systems and intact cells

By anticipating these common pitfalls, researchers can design more robust experiments that yield reliable insights into the function of lgt in bacterial lipoprotein processing across different species, including B. halodurans.

What are the most promising applications of recombinant B. halodurans lgt in biotechnology?

Recombinant B. halodurans lgt offers several innovative applications in biotechnology, particularly leveraging its unique properties as an enzyme from an alkaliphilic and moderately thermophilic bacterium:

1. Antibiotic-free selection systems:
The most developed application is using lgt as a selection marker for plasmid maintenance without antibiotics. This system offers significant advantages:

  • Eliminates antibiotic resistance genes from production strains

  • Prevents antibiotic residues in final products

  • Reduces environmental release of antibiotics and resistance genes

  • Maintains plasmid stability comparable to antibiotic selection systems

  • Demonstrates scalability to industrial production volumes

2. Protein anchoring technology:

  • Development of engineered bacterial surface display systems

  • Creation of immobilized enzyme systems with enhanced stability

  • Design of bacterial biosensors with membrane-anchored recognition elements

  • Production of vaccine candidates with lipidated antigens for improved immunogenicity

3. Lipoprotein engineering platform:

  • Controlled modification of recombinant proteins with lipid anchors

  • Production of stabilized membrane-associated proteins for structural studies

  • Development of lipidated peptide therapeutics with enhanced pharmacokinetics

  • Engineering of membrane-anchored multi-enzyme complexes for biocatalysis

4. Thermostable enzyme applications:
The inherent thermostability of B. halodurans enzymes (activity at 50-60°C) provides advantages for:

  • Processes requiring elevated temperatures to prevent contamination

  • Applications in environments experiencing temperature fluctuations

  • Increased reaction rates at higher temperatures

  • Extended shelf-life and operational stability

5. Alkaline-active enzyme applications:
The functionality at alkaline pH enables:

  • Use in industrial processes requiring alkaline conditions

  • Applications in detergent formulations

  • Processes where conventional enzymes lose activity at high pH

  • Bioremediation in alkaline environments

Comparative advantages table:

ApplicationConventional approachesB. halodurans lgt advantages
Plasmid selectionAntibiotic resistanceNo antibiotics, extreme stability
Protein anchoringChemical conjugationSite-specific, enzymatic process
BiocatalysisMesophilic enzymesHigher temperature tolerance
Alkaline processespH-sensitive enzymesNative activity at high pH

These applications represent the translation of basic research on B. halodurans lgt into biotechnological innovations with potential impacts across pharmaceutical, industrial enzyme, and recombinant protein production sectors.

What research gaps exist in our understanding of B. halodurans lgt compared to lgt from other bacterial species?

Despite advances in understanding bacterial lipoprotein processing, several significant knowledge gaps remain regarding B. halodurans lgt compared to better-characterized homologs:

1. Structural and mechanistic gaps:

  • No crystal structure is available for B. halodurans lgt

  • The catalytic mechanism in alkaliphilic bacteria remains uncharacterized

  • How B. halodurans lgt maintains activity at elevated pH is unknown

  • Structural adaptations enabling thermostability are not defined

2. Substrate specificity differences:

  • The lipobox recognition motif may differ in alkaliphilic bacteria

  • Whether B. halodurans lgt has broader or narrower substrate specificity is unresolved

  • The complete lipoprotein repertoire (lipoproteome) of B. halodurans remains undetermined

  • How substrate recognition differs from mesophilic bacteria is unclear

3. Physiological role uncertainties:

  • The complete set of lipoproteins affected by lgt in B. halodurans is unknown

  • How lipoprotein processing connects to alkaline adaptation mechanisms needs investigation

  • Potential interactions with other membrane proteins remain unexplored

  • The impact of growth conditions on lipoprotein processing efficiency is undefined

4. Technological development needs:

  • Optimized expression systems specifically for B. halodurans lgt

  • Specialized activity assays accounting for alkaliphilic properties

  • Advanced structural biology approaches for membrane protein characterization

  • Development of B. halodurans as an expression host for heterologous lipoproteins

5. Comparative biochemistry questions:

  • How kinetic parameters compare with homologs from mesophilic bacteria

  • Whether lipid substrate preferences differ in alkaliphilic bacteria

  • If the enzyme displays unique inhibitor sensitivity profiles

  • Whether post-translational modifications affect enzyme function

Research priority matrix:

Research areaCurrent knowledge levelPriority for investigationPotential impact
Structural determinationLowHighCritical for mechanism understanding
Substrate specificityLow-MediumHighEssential for biotechnology applications
Physiological roleLowMediumImportant for fundamental biology
Expression optimizationMediumMediumNeeded for applied research
Comparative enzymologyLowMedium-HighValuable for enzyme engineering

Addressing these knowledge gaps will require interdisciplinary approaches combining structural biology, biochemistry, molecular genetics, and systems biology to fully understand the unique properties of B. halodurans lgt and its potential biotechnological applications.

What emerging technologies might enhance our ability to study and utilize B. halodurans lgt?

Several cutting-edge technologies are poised to revolutionize research on B. halodurans lgt, potentially addressing current limitations and opening new research avenues:

1. Advanced structural biology approaches:

  • Cryo-electron microscopy (cryo-EM):

    • Enables visualization of membrane proteins without crystallization

    • Recent advances in resolution allow atomic-level details

    • Captures different conformational states of the enzyme

    • Application potential: Determining B. halodurans lgt structure in native-like environments

  • Integrative structural biology:

    • Combines multiple techniques (cryo-EM, NMR, SAXS, computational modeling)

    • Provides comprehensive structural understanding

    • Application potential: Elucidating dynamic aspects of lgt-substrate interactions

2. Genome engineering and synthetic biology tools:

  • CRISPR-Cas9 systems adapted for B. halodurans:

    • Enables precise genome editing

    • Facilitates rapid strain engineering

    • Application potential: Creating knockout, knockdown, and reporter strains

  • Synthetic gene circuits:

    • Control expression with unprecedented precision

    • Enable dynamic regulation

    • Application potential: Creating inducible systems for functional studies

3. Advanced proteomics approaches:

  • Top-down proteomics:

    • Analyzes intact proteins with post-translational modifications

    • Provides comprehensive view of processing events

    • Application potential: Characterizing the complete lipidation landscape

  • Proximity labeling proteomics:

    • Identifies protein-protein interactions in native cellular environments

    • Reveals functional protein complexes

    • Application potential: Mapping the lgt interactome

4. Microfluidics and high-throughput screening:

  • Droplet microfluidics:

    • Enables screening millions of enzyme variants

    • Dramatically accelerates directed evolution

    • Application potential: Engineering lgt with enhanced properties

  • Microfluidic cell-free expression systems:

    • Rapid prototyping of expression constructs

    • Miniaturized reaction volumes

    • Application potential: Optimizing expression conditions efficiently

5. Computational and AI-based approaches:

  • Machine learning for protein engineering:

    • Predicts beneficial mutations from sequence data

    • Accelerates enzyme optimization

    • Application potential: Designing lgt variants with enhanced stability or activity

  • Molecular dynamics simulations:

    • Models protein behavior in membrane environments

    • Reveals dynamic aspects of catalysis

    • Application potential: Understanding mechanism of alkaline adaptation

6. Single-molecule techniques:

  • Single-molecule FRET:

    • Observes individual enzyme molecules during catalysis

    • Reveals conformational dynamics

    • Application potential: Visualizing catalytic cycle steps

  • Nanopore-based sensing:

    • Detects single molecules with high sensitivity

    • Enables real-time monitoring

    • Application potential: Developing novel lgt activity assays

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.