Recombinant Bacillus halodurans Sensor protein BceS (bceS)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and the protein's inherent stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The specific tag will be determined during production. If you require a particular tag, please inform us, and we will prioritize its development.
Synonyms
bceS; BH3912; Sensor protein BceS
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-334
Protein Length
full length protein
Species
Bacillus halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125)
Target Names
bceS
Target Protein Sequence
MIKTFIKERGSWILIIIFLQCFTVFIAYLDSAIPLAPVFYSVFLSSMIFLFFLAVRYKKE TTFYRKLEEWDKDLDVTNLAAAESPFERIIEQTIVKQTGYLQEKAHRHETALEQEKDDLL AWIHEIKTPLTAMHLIIDRLEDRTIKGQLTYEWMRIHLLLDQQLHQKRIPFMENDLYVEK VNLESVLHQEIKTLQSWCIQKGIGFDLQLEVTDVLTDAKWLSFILRQLLSNAVKYSEASD IIIKSDVVSGKTVVEVTDFGRGIEPKDLPRIFEKGFTSTKTDQTNGATGMGLYLAKRVAE PLLIDLAVSSTVGEGTTFTLTFPKENEFVRTLGM
Uniprot No.

Target Background

Function
Bacillus halodurans Sensor protein BceS (bceS) is a component of the two-component regulatory system BceS/BceR, responsible for regulating bacitracin resistance. It activates BceR in response to extracellular bacitracin.
Database Links

KEGG: bha:BH3912

STRING: 272558.BH3912

Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is the BceS sensor protein and what is its primary function?

BceS is a membrane-bound histidine kinase that forms part of a two-component regulatory system (BceRS) in Bacillus species and other Firmicutes. Its primary function involves sensing antimicrobial peptides, particularly bacitracin, and initiating signal transduction that leads to expression of resistance genes. Unlike conventional histidine kinases, BceS lacks typical sensory domains and instead functions in a complex with an ABC transporter (BceAB) to detect antimicrobial peptides and respond appropriately . This unique arrangement allows the bacterium to finely tune its response to antibiotic threats, modulating gene expression across a wide dynamic range based on the severity of the antimicrobial challenge .

How does the BceABRS system function as a coordinated unit?

The BceABRS system functions as a four-component system where the ABC transporter (BceAB) and two-component system (BceRS) work together in sensing and responding to antimicrobial peptides. When bacitracin or other peptide antibiotics are present, the BceAB transporter acts as a co-sensor with BceS. Upon activation, BceS autophosphorylates and transfers the phosphate group to BceR, which then binds to a conserved DNA motif in the promoter region of target genes, including the bceAB operon itself . This creates a positive feedback loop, increasing the expression of the transporter and enhancing resistance. This system produces an "exquisitely fine-tuned response" with three orders of magnitude of output modulation over an equivalent input dynamic range .

What is the domain architecture of BceS?

BceS has a relatively simple domain architecture consisting of:

  • Two transmembrane domains

  • A poorly conserved HAMP-like domain in the cytoplasmic region

  • A DHp (dimerization and histidine phosphotransfer) domain containing the conserved histidine residue that gets phosphorylated

  • A catalytic ATP-binding domain (CA domain)

Unlike many other histidine kinases, BceS lacks obvious extracellular sensory domains, which explains its dependence on the BceAB transporter for signal detection . The HAMP-like domain in BceS lacks the conserved Pro residue in helix 1 and Glu in helix 2 that are typical of canonical HAMP domains, suggesting a potentially unique mechanism of signal transduction .

What methods are effective for producing recombinant BceS for structural studies?

Recombinant BceS can be effectively produced using E. coli expression systems, as demonstrated by commercial preparations like the Bacillus halodurans BceS from CUSABIO (CSB-EP885074BQS1) . For structural studies, researchers typically use:

  • Optimized E. coli expression systems: BL21(DE3) or similar strains with expression vectors containing T7 or tac promoters.

  • Fusion tags: Histidine tags (His₈) are commonly used to facilitate purification while maintaining protein function. This approach has been validated in studies where BceS-His₈ constructs retained signaling functionality .

  • Membrane protein extraction: Protocols using mild detergents like n-dodecyl-β-D-maltoside (DDM) or lauryl maltose neopentyl glycol (LMNG) to extract and maintain the native conformation of the membrane-embedded BceS.

  • Reconstitution systems: Nanodiscs or liposomes for studying BceS in a lipid environment that mimics its native membrane context.

When producing recombinant BceS, it's crucial to verify that the protein remains properly folded and functional, typically through activity assays that measure autophosphorylation or phosphotransfer to BceR .

How can researchers effectively assay BceS activity in experimental settings?

Several complementary approaches can be used to assay BceS activity:

  • Reporter gene assays: Using luciferase (luxABCDE) or β-galactosidase reporters fused to BceR-dependent promoters (like PbceA) to measure pathway activation. This approach has been extensively used to quantify signaling in response to varying concentrations of bacitracin .

  • In vitro phosphorylation assays: Using purified BceS to measure:

    • Autophosphorylation rates

    • Phosphotransfer to BceR

    • Phosphatase activity toward phosphorylated BceR

  • Cysteine accessibility and crosslinking analysis: Introducing cysteine residues at specific positions in BceS and analyzing their accessibility to thiol-reactive reagents or their ability to form disulfide bonds. This approach has been used to study conformational changes in BceS during activation .

  • Bacitracin sensitivity assays: Comparing minimum inhibitory concentrations (MICs) or growth curves of wild-type and mutant strains in the presence of various concentrations of bacitracin to assess the functional impact of BceS variants .

  • Protein-protein interaction assays: Methods such as bacterial two-hybrid assays, co-immunoprecipitation, or FRET to study interactions between BceS and other components of the system (BceA, BceB, BceR) .

What expression systems and purification strategies yield the highest quality recombinant BceS protein?

Based on the available information, the following strategies yield high-quality recombinant BceS:

Expression systems:

  • E. coli BL21(DE3) or similar strains show good expression of BceS, as demonstrated by commercial preparations .

  • Expression under control of inducible promoters (T7, tac, or xylose-inducible promoters for complementation studies in Bacillus) .

Purification strategies:

  • Affinity chromatography using histidine tags (His₈) followed by size exclusion chromatography.

  • Specialized membrane protein purification techniques using appropriate detergents.

  • Tag placement at the C-terminus appears to preserve function better than N-terminal tags .

Storage conditions:

  • Liquid form stability: 6 months at -20°C/-80°C

  • Lyophilized form stability: 12 months at -20°C/-80°C

  • Reconstitution in deionized sterile water to 0.1-1.0 mg/mL, with 5-50% glycerol for long-term storage .

For optimal results, researchers should verify the purity (>85% by SDS-PAGE) and functional state of the purified protein through activity assays before using it for structural or biochemical studies .

How do conformational changes in BceS contribute to signal transduction?

BceS undergoes specific conformational changes during signal transduction that are critical for its function:

  • Helical rotations in the DHp domain: Research using cysteine crosslinking and accessibility analyses has demonstrated that BceS activation involves rotational movements of the helices in the DHp domain. These rotations reposition the conserved histidine residue, facilitating autophosphorylation .

  • Piston movement in transmembrane helix 2: Evidence suggests that the second transmembrane domain undergoes a piston-like vertical displacement during activation. This was demonstrated by introducing arginine residues near the membrane interface (positions W54, F55, and Y57), which caused signal-independent activation similar to what has been observed in other histidine kinases like E. coli DcuS .

  • Role of the HAMP-like domain: Despite lacking canonical HAMP domain features, the intervening region between the transmembrane and DHp domains appears to relay physical motions. Key residues like L67 (corresponding to the small hydrophobic residue that controls packing in canonical HAMP domains) influence signal responsiveness and kinase activity .

  • Charge distribution in the DHp core: The arrangement of charged residues within the DHp domain core affects kinase activity. Mutations altering charge distribution in this region have been shown to significantly impact signaling both in the presence and absence of bacitracin .

These conformational changes collectively convert the external signal (presence of antimicrobial peptides detected by the BceAB transporter) into kinase activation and subsequent phosphorylation of the response regulator BceR.

What is the molecular basis for the interaction between BceS and the BceAB transporter?

The molecular basis for the interaction between BceS and the BceAB transporter involves:

  • Physical proximity and complex formation: Evidence suggests that BceS and BceAB form a functional complex in the membrane. This complex is essential for signal detection, as BceS lacks traditional sensory domains and depends on BceAB for sensing antimicrobial peptides .

  • C-terminal region of BceB: Mutagenesis studies have identified a region in BceB with a high density of mutations that lead to loss of signaling, suggesting this region is crucial for communication between the transporter and kinase . Specifically, the C-terminal part of this region appears to be involved in coupling to the ATPase activity of the transporter.

  • Dual role of BceAB: The transporter not only activates BceS in response to antimicrobial peptides but also controls its inactive state. This complete control over kinase conformation couples BceS activity to that of the transporter .

  • Specific protein-protein interactions: Residues like Y64 in BceS appear to be involved in protein-protein interactions that prevent its labeling in cysteine accessibility experiments, suggesting this residue may participate in the interface between BceS and BceB .

  • Sensitivity tuning: Mutations in certain regions of BceB alter the sensitivity of signaling, with some variants responding to much lower concentrations of bacitracin (0.03 μg/ml compared to 3 μg/ml for wild-type). This suggests that the transporter can fine-tune the system's response to antimicrobial peptides .

The exact structural details of this interaction remain to be fully elucidated, but it represents a unique mechanism of histidine kinase activation that differs from conventional two-component systems.

How does the BceS-mediated signaling response correlate with antimicrobial peptide concentration?

BceS-mediated signaling shows a remarkable correlation with antimicrobial peptide concentration, displaying:

  • Wide dynamic range: The BceABRS system produces "an exquisitely fine-tuned response, with three orders of magnitude of output modulation over an input dynamic range of three orders of magnitude" . This allows the bacteria to proportionally adjust their defensive response according to the severity of the antibiotic threat.

  • Analog-like signaling behavior: Unlike many two-component systems that function in a more digital (on/off) manner, the BceABRS system shows analog-like behavior with a graded response proportional to input stimulus levels .

  • Threshold variations: Wild-type BceS systems typically begin signaling at approximately 3 μg/ml bacitracin, while certain mutations can shift this threshold up to 10 μg/ml or down to as low as 0.03 μg/ml . This demonstrates how the system's sensitivity can be fine-tuned through subtle changes in protein structure.

  • Positive feedback loop: BceR regulates expression of the bceAB operon, creating a positive feedback loop that amplifies the response as antimicrobial peptide concentrations increase . This allows for rapid adaptation to increasing antibiotic challenges.

  • Specificity in antimicrobial peptide recognition: Different Bce-modules (BceAB-RS, PsdAB-RS, ApeAB-RS) in B. subtilis respond to distinct sets of antimicrobial peptides, with BceAB-RS responding strongly to bacitracin, mersacidin, actagardine, and plectasin .

This sophisticated dose-response relationship enables bacterial cells to efficiently allocate resources for defense, producing just enough resistance proteins to counter the present threat without unnecessary metabolic burden.

How do BceS homologs differ between Bacillus halodurans and other bacterial species?

FeatureBacillus halodurans BceSBacillus subtilis BceSStreptococcus mutans BceS
Primary FunctionSensor protein in two-component system for antimicrobial peptide resistance Sensor histidine kinase that responds to bacitracin and other peptide antibiotics Component of bacitracin resistance mechanism
Key InteractionsForms complex with BceAB transporter (predicted)Forms functional complex with BceAB transporter Requires intact BceAB transporter for bacitracin sensing
Genetic OrganizationNot specified in available resultsbceABRS operon with positive autoregulation bceABRS operon (formerly mbrABCD) with positive autoregulation
Signal TransductionHistidine kinase activity (EC 2.7.13.3) Activation via helical rotations in DHp domain and piston movement in TM2 Phosphorylated BceR binds to conserved invert repeat in promoter region
Regulatory NetworkNot specified in available resultsControls BceR regulon including bceAB operon Controls bceABRS operon and at least three additional genes forming the BceRS regulon
Structural FeaturesPartial recombinant protein available for study Contains HAMP-like domain lacking canonical features; has charged residues in DHp core affecting activity Not specified in available results

The three BceS homologs share the core function of sensing antimicrobial peptides in cooperation with ABC transporters, but they have evolved species-specific variations in regulatory networks and molecular mechanisms .

What are the key structural and functional differences between BceS and other histidine kinases?

BceS exhibits several distinctive features compared to conventional histidine kinases:

  • Lack of traditional sensory domains: Unlike most histidine kinases that directly sense environmental stimuli through extracellular or periplasmic domains, BceS lacks apparent sensory domains and instead depends on the BceAB transporter for signal detection .

  • Co-sensor mechanism: BceS functions in a sensory complex with an ABC transporter (BceAB), representing an unusual strategy where the transporter both provides resistance and serves as a sensor for antimicrobial peptides .

  • Atypical HAMP-like domain: While BceS contains a region between its transmembrane and DHp domains that likely functions similarly to a HAMP domain, it lacks the conserved Pro residue in helix 1 and Glu in helix 2 that are typical for canonical HAMP domains .

  • Analog signaling behavior: BceS-mediated signaling produces an exceptionally wide dynamic range of response proportional to stimulus intensity, unlike many histidine kinases that function more as binary switches .

  • Transporter-dependent activation: Deletion of either bceA or bceB abolishes BceS-mediated bacitracin sensing, demonstrating an essential role for the transporter in kinase function . This contrasts with conventional histidine kinases that can function independently of transporters.

  • Dual control by transporter: The BceAB transporter not only activates BceS in response to antimicrobial peptides but also controls its inactive state, providing complete control over kinase conformation .

These unique characteristics make BceS and similar systems valuable models for understanding diverse mechanisms of bacterial signal transduction and developing targeted approaches to overcome antimicrobial resistance.

What genetic strategies can be used to study BceS function in vivo?

Several genetic strategies have proven effective for studying BceS function in vivo:

  • Gene knockouts and complementation: Creating bceS deletion mutants and complementing them with plasmid-expressed wild-type or mutant versions. This approach has been used successfully with shuttle vectors like pDL278 carrying wild-type copies of bceS under the control of inducible promoters (e.g., xylose-inducible promoters) .

  • Site-directed mutagenesis: Introducing specific amino acid substitutions to test hypotheses about structure-function relationships. This approach has revealed the importance of:

    • Charged residues in the DHp domain core (e.g., R115E, K116E)

    • Key residues in the HAMP-like domain (e.g., L67A)

    • Positions at the membrane interface (W54R, F55R, Y57R)

  • Cysteine substitution mutagenesis: Replacing specific residues with cysteine for subsequent accessibility and crosslinking studies. This approach has been instrumental in mapping conformational changes associated with BceS activation .

  • Reporter gene fusions: Fusing promoters of BceR-regulated genes to reporter genes like luxABCDE (luciferase) or lacZ (β-galactosidase) to quantitatively measure signaling output .

  • His-tagged constructs: Adding histidine tags (e.g., His₈) to facilitate protein detection by Western blotting while maintaining function. This approach has confirmed membrane localization and expression levels of BceS variants .

  • Genomic searches for BceR binding motifs: Identifying additional genes regulated by the BceRS system by searching for the consensus BceR binding motif in promoter regions. This approach has identified three additional genes in the BceRS regulon of S. mutans beyond the bceABRS operon itself .

These genetic tools provide complementary approaches to dissect BceS function and its role in antimicrobial peptide resistance.

How can researchers optimize expression of recombinant BceS for structural and biochemical studies?

Optimizing expression of recombinant BceS requires addressing several challenges associated with membrane protein production:

  • Expression system selection:

    • E. coli BL21(DE3) or derivatives are commonly used for recombinant BceS production .

    • Consider specialized strains like C41(DE3) or C43(DE3) designed for membrane protein expression.

    • For native-like post-translational modifications, Bacillus-based expression systems may be preferable.

  • Vector design considerations:

    • Use low-copy-number vectors for complementation studies to avoid toxicity from overexpression .

    • Include native promoter elements when studying regulation.

    • For high-yield production, use strong inducible promoters (T7, tac).

    • Incorporate appropriate ribosome-binding sites and codon optimization for the expression host .

  • Fusion tags and purification strategies:

    • C-terminal His₈ tags have been successfully used without disrupting BceS function .

    • Consider fusion to MBP, SUMO, or other solubility-enhancing partners for improved expression.

    • GFP fusions can help monitor protein folding and membrane insertion.

  • Membrane extraction and protein stability:

    • Optimize detergent selection for extraction (DDM, LMNG, etc.).

    • Include glycerol (5-50%) in storage buffers to extend shelf life .

    • For lyophilized preparations, expect stability up to 12 months at -20°C/-80°C .

  • Quality control:

    • Verify purity by SDS-PAGE (aim for >85%) .

    • Confirm membrane localization by Western blotting.

    • Validate functionality through activity assays.

  • Reconstitution for functional studies:

    • Consider nanodiscs or proteoliposomes for a native-like membrane environment.

    • Co-expression with BceAB may be necessary for proper complex formation and stability.

By systematically optimizing these parameters, researchers can obtain sufficient quantities of properly folded, functional BceS for structural and biochemical characterization.

How does the BceABRS system contribute to antimicrobial peptide resistance mechanisms?

The BceABRS system contributes to antimicrobial peptide resistance through several coordinated mechanisms:

  • Detection and signaling: The BceAB transporter, in complex with BceS, detects the presence of antimicrobial peptides like bacitracin. This activates BceS, leading to phosphorylation of BceR .

  • Transcriptional upregulation: Phosphorylated BceR binds to a conserved DNA motif in target promoters, particularly the bceAB operon, increasing expression of the resistance transporter .

  • Positive feedback amplification: Increased BceAB production enhances both sensing capability and resistance, creating a positive feedback loop that amplifies the response proportionally to the severity of the antimicrobial challenge .

  • Direct resistance mechanism: The BceAB transporter itself provides protection, likely by removing antimicrobial peptides from their site of action or transporting them away from sensitive cellular targets .

  • Regulon activation: Beyond the bceAB operon, BceR activates additional genes that share the BceR binding motif in their promoter regions, expanding the resistance response. In S. mutans, three additional genes form part of the BceRS regulon .

  • Fine-tuned response: The system produces a precisely calibrated response across three orders of magnitude of input (antimicrobial concentration) and output (gene expression), allowing efficient resource allocation for defense .

This multifaceted resistance mechanism is widely conserved among Firmicutes, with species-specific variations in the exact peptides recognized and the regulatory networks involved .

What experimental approaches can be used to assess the impact of BceS mutations on antimicrobial peptide resistance?

Several complementary experimental approaches can effectively assess how BceS mutations impact antimicrobial peptide resistance:

  • Minimum Inhibitory Concentration (MIC) assays:

    • Compare growth inhibition of wild-type and mutant strains across a range of antimicrobial peptide concentrations.

    • Quantify resistance shifts through standard MIC determinations in liquid or solid media.

  • Growth curve analysis:

    • Monitor bacterial growth kinetics in the presence of sub-lethal antimicrobial peptide concentrations.

    • Compare lag phase duration, growth rate, and final optical density between wild-type and mutant strains.

  • Reporter gene assays:

    • Use promoter-reporter fusions (luxABCDE, lacZ) to quantify BceRS-dependent gene expression in response to antimicrobial peptides .

    • Determine EC50 values (effective concentration for half-maximal response) for different BceS variants.

    • Construct dose-response curves to assess changes in sensitivity thresholds, which can vary from 0.03 μg/ml to 10 μg/ml bacitracin depending on the mutation .

  • Genetic complementation:

    • Express wild-type BceS from plasmids in bceS deletion strains to confirm phenotype restoration.

    • Use site-directed mutagenesis to introduce specific changes and assess their effects in vivo .

  • Cysteine accessibility and crosslinking analysis:

    • Compare conformational states of wild-type and mutant BceS proteins using cysteine labeling.

    • Quantify differences in crosslinking patterns that reflect altered protein dynamics .

  • Protein-protein interaction studies:

    • Assess how mutations affect BceS interaction with the BceAB transporter using co-immunoprecipitation or bacterial two-hybrid assays.

    • Evaluate BceS-BceR interactions through phosphotransfer assays.

  • Computational prediction validation:

    • Use molecular dynamics simulations to predict effects of mutations.

    • Validate computational predictions through experimental approaches above .

Using these approaches in combination provides a comprehensive understanding of how specific BceS mutations impact antimicrobial peptide sensing, signal transduction, and resistance phenotypes.

What are the current gaps in our understanding of BceS function and structure?

Despite significant advances, several important gaps remain in our understanding of BceS function and structure:

  • High-resolution structural information: No crystal or cryo-EM structures of BceS are currently available in the literature. Such structures would provide critical insights into:

    • The exact configuration of the transmembrane domains

    • The structure of the atypical HAMP-like domain

    • The conformational changes associated with activation

  • Molecular details of BceS-BceAB interaction: While functional studies indicate that BceS requires the BceAB transporter for sensing, the precise interaction interfaces and molecular mechanism of signal transmission from transporter to kinase remain poorly defined .

  • Ligand binding mechanism: How exactly antimicrobial peptides are recognized by the BceAB-BceS complex, including the binding site and conformational changes induced by ligand binding, is not fully understood .

  • Signal transduction pathway: The exact sequence of conformational changes that propagate from the membrane-spanning domains through the HAMP-like domain to the DHp and catalytic domains requires further elucidation .

  • Regulatory network complexity: The full extent of genes regulated by BceR in different species and how these contribute to antimicrobial peptide resistance remains to be fully characterized .

  • Species-specific variations: While the BceABRS system has been well-studied in B. subtilis, less is known about the specific properties and mechanisms of homologous systems in other bacteria, including Bacillus halodurans .

  • Evolutionary relationships: A comprehensive understanding of how these systems evolved and diversified across different bacterial species would provide insights into adaptation to various ecological niches and antimicrobial challenges.

Addressing these gaps would significantly advance our understanding of this important class of antimicrobial peptide resistance systems and potentially inform strategies to combat antibiotic resistance.

How might research on BceS contribute to developing new antimicrobial strategies?

Research on BceS could contribute to developing novel antimicrobial strategies in several promising ways:

  • Target for adjuvant therapy: Inhibitors of BceS or the BceS-BceAB interaction could serve as adjuvants to restore sensitivity to antimicrobial peptides like bacitracin. This approach could revitalize the clinical utility of existing antibiotics facing resistance challenges .

  • Combination therapy rationale: Understanding the BceS signaling threshold and dose-response characteristics could inform optimal dosing strategies for combination therapies involving antimicrobial peptides and Bce-system inhibitors .

  • Novel drug target identification: The unique features of BceS, such as its dependence on the BceAB transporter for sensing, present potential targets for designing selective inhibitors that would not affect human proteins .

  • Resistance prediction models: Detailed knowledge of how specific mutations alter BceS function could help predict the emergence of resistance and guide preemptive therapeutic strategies .

  • Biosensor development: Engineered BceS systems could be developed as biosensors for detecting antimicrobial peptides in environmental or clinical samples, potentially aiding in diagnostics or antibiotic discovery pipelines.

  • Structural biology insights: High-resolution structures of BceS in different conformational states could facilitate structure-based drug design targeting this unique signal transduction system .

  • Broad-spectrum approaches: Comparative studies of BceS across different bacterial species could identify conserved features as targets for broad-spectrum therapeutic interventions against multiple pathogenic bacteria .

  • Counter-resistance strategies: Understanding the positive feedback mechanism of the BceABRS system could inform strategies to disrupt this amplification and prevent the development of high-level resistance .

By targeting the sensing and signaling mechanisms that bacteria use to detect and respond to antimicrobial threats, rather than directly targeting essential cellular processes, these approaches might face reduced selective pressure for resistance development and provide valuable adjuncts to our antimicrobial arsenal.

What are the most significant recent advances in BceS research?

The most significant recent advances in BceS research include:

  • Mechanistic understanding of signal transduction: Detailed characterization of the conformational changes involved in BceS activation, including helical rotations in the DHp domain and piston movements in the second transmembrane domain .

  • Co-sensory complex model: Establishment of the model whereby the BceAB transporter functions not only in resistance but also as an essential co-sensor with BceS, with the transporter controlling both the active and inactive states of the kinase .

  • Structural insights: Identification of key structural elements in BceS, including the atypical HAMP-like domain and the importance of charged residues in the DHp core for kinase function .

  • Fine-tuned response characterization: Documentation of the system's remarkable capability to produce three orders of magnitude of output modulation over an equivalent input dynamic range, representing an exceptionally fine-tuned response to antimicrobial challenge .

  • Regulatory network expansion: Identification of additional genes controlled by BceR beyond the bceAB operon, revealing broader regulatory networks involved in antimicrobial peptide resistance .

  • Mutational analysis: Comprehensive mutagenesis studies identifying specific residues critical for BceS function and interaction with the BceAB transporter .

  • Comparative analysis across species: Recognition of the conservation of Bce-modules across Firmicutes, with species-specific variations in peptide recognition profiles and regulatory networks .

These advances collectively provide a much more sophisticated understanding of how bacteria sense and respond to antimicrobial peptides, opening new avenues for therapeutic intervention and antibiotic development.

How should researchers approach designing experiments to further elucidate BceS function?

Researchers designing experiments to further elucidate BceS function should consider a multi-faceted approach:

  • Integrate structural biology with functional analysis:

    • Pursue high-resolution structures of BceS alone and in complex with BceAB using cryo-EM or X-ray crystallography.

    • Complement structural studies with functional assays to correlate structural features with signaling capabilities.

    • Use computational approaches like molecular dynamics simulations to predict conformational changes and guide experimental design .

  • Employ complementary genetic approaches:

    • Combine site-directed mutagenesis with random mutagenesis to identify both expected and unexpected functional residues.

    • Use suppressor mutation analysis to identify interacting residues within the protein or between BceS and BceAB.

    • Apply CRISPR-based genome editing for precise chromosomal modifications .

  • Develop improved biochemical assays:

    • Establish reconstituted systems with purified components to study direct interactions.

    • Develop high-throughput assays for screening potential inhibitors of BceS function.

    • Use advanced biophysical techniques like hydrogen-deuterium exchange mass spectrometry to map conformational changes .

  • Adopt systems biology perspectives:

    • Apply transcriptomics and proteomics to comprehensively map the BceRS regulon across conditions and species.

    • Use network analysis to understand how BceS-mediated signaling integrates with other stress responses.

    • Develop mathematical models of the dose-response relationship to predict system behavior under various conditions .

  • Examine evolutionary aspects:

    • Conduct comparative studies across diverse bacterial species to understand the evolution and specialization of BceS homologs.

    • Analyze natural variation in BceS sequences to identify regions under selective pressure.

    • Reconstruct ancestral sequences to understand the evolutionary trajectory of these systems.

  • Consider translational applications:

    • Screen for small molecule modulators of BceS function as potential adjuvants for antimicrobial therapy.

    • Explore engineering BceS-based biosensors for detecting antimicrobial peptides.

    • Investigate how BceS contributes to resistance in clinical bacterial isolates .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.