Recombinant Bacillus halodurans Thiol-disulfide oxidoreductase resA (resA)

Shipped with Ice Packs
In Stock

Description

Introduction to Recombinant Bacillus halodurans Thiol-disulfide Oxidoreductase ResA (ResA)

Recombinant Bacillus halodurans Thiol-disulfide Oxidoreductase ResA (ResA) is an enzyme that belongs to the family of thiol-disulfide oxidoreductases. These enzymes catalyze the formation and breakage of disulfide bonds within proteins, which is crucial for proper protein folding, stability, and function . ResA, specifically, is involved in the maturation of c-type cytochromes, which are essential components of electron transport chains in bacteria .

Bacillus halodurans is an alkaline bacterium known for its ability to thrive in high-pH environments . ResA from Bacillus subtilis has been studied to understand the substrate specificity in c-type cytochrome maturation . Unlike other thiol-disulfide oxidoreductases, ResA exhibits specificity for cytochrome c550 and uses alternate conformations to recognize redox partners .

Function and Mechanism

ResA plays a vital role in the cytochrome c maturation (CCM) system by reducing oxidized apocytochrome c, which is a necessary step for the covalent attachment of heme cofactors via thioether bonds . This process is unique to c-type cytochromes .

The enzyme utilizes a redox-dependent conformational change between oxidation states to recognize its redox partners . Solution NMR evidence indicates that ResA has a surface cavity present only in the reduced state, which it uses to recognize a peptide derived from cytochrome c550 .

Substrate Specificity

ResA is a specific thiol-disulfide oxidoreductase, unlike most thiol-disulfide oxidoreductases that are non-specific . It preferentially reduces an oxidized C-x-x-C-H motif found within a mimetic peptide derived from cytochrome c550, compared to oxidized glutathione (GSSG) . The midpoint potential (EmE_m) of the mimetic peptide is more negative than that of glutathione, suggesting that substrate-specific recognition, rather than differences in midpoint potentials, dictates the enhanced rate of conversion .

Table 1. Comparison of ResA Reactivity with Peptide and GSSG

ConcentrationPeptide rate, min-1GSSG rate, min-1
1 mM0.0108 ± 0.00120.00725 ± 0.0005
250 μM0.0036 ± 0.00020.0015 ± 0.0003
62.5 μM0.00186 ± 0.0003N.D.

N.D. = Not Determined

Role as an Electron Control Point

ResA functions as a control point in the utilization of thioredoxin-derived reducing equivalents for bacterial extracellular and periplasmic activities . It ensures that electrons are directed into protein maturation pathways only when apocytochrome c is directly available . ResA, in its reduced form, binds specifically to oxidized apocytochrome c, preventing the loss of electrons to random disulfides in the extracellular environment .

Biotechnological Applications

Bacillus halodurans laccase has been immobilized on the S-layer lattice formed by SbpA of Lysinibacillus sphaericus CCM 2177 through covalent linkage and fusion protein construction, to organize functional materials at the nanometer scale . The S-layer part of the fusion protein confers a much higher solubility on the laccase as observed for the sole enzyme . Recombinant laccase (rLac) immobilized on the SbpA lattice exhibits higher enzymatic activity compared to the fusion protein .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for fulfillment based on your requirements.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, which can be used as a reference.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer components, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us; we will prioritize its development.
Synonyms
resA; BH1577; Thiol-disulfide oxidoreductase ResA
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-176
Protein Length
full length protein
Species
Bacillus halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125)
Target Names
resA
Target Protein Sequence
MDKRKRFWMRLSILAVISVALGYTFYSNFFADRSLARAGEQAVNFVLEDLEGESIELREL EGKGVFLNFWGTYCPPCEREMPHMEKLYGEYKEQGVEIIAVNANEPELTVQRFVDRYGLS FPIVIDKGLNVIDAYGIRPLPTTILINEHGEIVKVHTGGMTEQMVEEFMELIKPEA
Uniprot No.

Target Background

Function

Thiol-disulfide oxidoreductase essential for disulfide bond reduction during c-type cytochrome synthesis. It may accept reducing equivalents from CcdA, facilitating the breakage of disulfide bonds in apocytochrome c, enabling subsequent covalent heme attachment.

Database Links

KEGG: bha:BH1577

STRING: 272558.BH1577

Protein Families
Thioredoxin family, ResA subfamily
Subcellular Location
Cell membrane; Single-pass type II membrane protein.

Q&A

What is Bacillus halodurans ResA and what is its primary function?

ResA is a membrane-anchored thiol-disulfide oxidoreductase (TDOR) in Bacillus halodurans that plays a crucial role in the cytochrome c maturation pathway. Similar to its homolog in B. subtilis, ResA functions primarily in the reductive pathway of disulfide bond formation, maintaining specific cysteine residues in their reduced state during the attachment of heme to cytochrome c apo-proteins . As a TDOR, it catalyzes the breaking and formation of disulfide bonds, which is essential for proper protein folding and function in the bacterial cell envelope. In B. halodurans, ResA likely exhibits enhanced stability in alkaline conditions, reflecting the adaptation of this alkaliphilic organism to its environmental niche .

How does ResA from B. halodurans differ from its homologs in other Bacillus species?

While the core catalytic function of ResA is conserved across Bacillus species, B. halodurans ResA likely contains adaptations that facilitate its function in alkaline environments. Comparative genomic analysis suggests that B. halodurans contains unique genes and regulatory elements compared to B. subtilis, which may contribute to its adaptation to more alkaline environments . These adaptations likely extend to ResA, potentially conferring increased stability and function at high pH. The thiol-disulfide oxidoreductase activity may be optimized for the periplasmic environment of this alkaliphile, potentially exhibiting different redox potential or substrate specificity compared to its neutrophilic counterparts like B. subtilis ResA .

What expression systems are recommended for producing recombinant B. halodurans ResA?

For recombinant expression of B. halodurans ResA, several expression systems can be considered:

The choice of expression tag (His6, GST, etc.) should consider the need for subsequent structural or functional studies. For membrane-associated variants of ResA, expression protocols should be optimized to facilitate proper membrane insertion and folding.

What are the recommended methods for purifying recombinant B. halodurans ResA?

Purification of recombinant B. halodurans ResA typically follows these steps:

  • Cell lysis: For the alkaliphilic B. halodurans, lysis buffers at pH 8.0-9.0 may improve protein stability. Standard methods including sonication or high-pressure homogenization in the presence of protease inhibitors are recommended.

  • Initial capture: If His-tagged, immobilized metal affinity chromatography (IMAC) using Ni-NTA or Co-based resins is effective. Load and wash buffers should contain 20-50 mM imidazole to reduce non-specific binding.

  • Further purification: Ion exchange chromatography (typically anion exchange at pH 8.0) followed by size exclusion chromatography produces high purity protein suitable for enzymatic and structural studies.

  • Buffer considerations: Throughout purification, maintain reducing conditions (typically 1-5 mM DTT or TCEP) to prevent non-native disulfide formation. For B. halodurans ResA, consider testing stability in buffers of varying pH (7.0-10.0) to determine optimal conditions.

  • Membrane-associated variants: If purifying full-length membrane-anchored ResA, detergent solubilization (typically 1% DDM or LDAO) is required during lysis, with lower detergent concentrations (0.05-0.1%) maintained throughout purification.

Protein purity should be assessed by SDS-PAGE, and activity can be confirmed through thiol-disulfide exchange assays.

What experimental approaches can determine the substrate specificity of B. halodurans ResA?

Understanding ResA substrate specificity requires multiple complementary approaches:

  • In vitro redox potential determination:

    • Equilibration with glutathione redox buffers followed by analysis of thiol oxidation state

    • Direct electrochemical methods using protein film voltammetry

    • These measurements provide the thermodynamic basis for ResA's preference for reduction vs. oxidation reactions

  • Kinetic analysis with model substrates:

    • Chromogenic substrates like DTNB (Ellman's reagent) for thiol-disulfide exchange rates

    • Insulin reduction assay for general disulfide reductase activity

    • Cytochrome c reduction assays for physiologically relevant activity

  • Direct binding studies with potential substrates:

    • Isothermal titration calorimetry (ITC) to determine binding affinities

    • Surface plasmon resonance (SPR) for association/dissociation kinetics

    • Differential scanning fluorimetry to assess ligand-induced stabilization

  • Structural analysis of substrate complexes:

    • X-ray crystallography of ResA with substrate analogs or trapped intermediates

    • NMR chemical shift analysis to identify substrate binding interfaces

    • Computational docking combined with site-directed mutagenesis validation

  • Comparative analysis:

    • Side-by-side comparison with B. subtilis ResA using identical substrates can highlight adaptations specific to B. halodurans' alkaliphilic lifestyle

These approaches together can reveal both the thermodynamic preference (redox potential) and kinetic specificity (substrate binding and catalysis rates) that determine ResA's functional role in vivo.

How can genetic manipulation systems be optimized for studying ResA function in B. halodurans?

Recent advances enable sophisticated genetic manipulation of B. halodurans through these approaches:

  • Optimized allelic replacement using pBASE_Bha system:
    The pBASE_Bha vector system can be used for:

    • Complete deletion of resA to create knockout strains

    • Introduction of point mutations to analyze specific residues

    • Insertion of epitope tags for localization studies

    • Addition of regulatory elements to control expression

    Key optimization parameters for B. halodurans include:

    • Using pH 8.5 growth medium rather than pH 10

    • Increasing anhydrotetracycline (ATc) concentration to 100 ng/mL for effective counter-selection

    • Chloramphenicol sensitivity testing to confirm plasmid loss

  • Design of homology regions:

    • For resA manipulation, use ~1 kb homology arms flanking the target region

    • Ensure regions don't contain sequences that might recombine elsewhere

    • Consider codon optimization when introducing mutations or tags

  • Phenotypic analysis of mutants:

    • Growth curve analysis under different oxygen conditions

    • Cytochrome c content quantification

    • Stress sensitivity tests (oxidative, pH, temperature)

    • Complementation studies to confirm phenotype causality

  • Expression control strategies:

    • Inducible promoter systems effective at alkaline pH

    • Anti-sense RNA approaches targeting resA can be implemented using the secY-based system described for B. halodurans

These genetic tools enable comprehensive functional characterization of ResA in its native alkaliphilic host context, rather than relying solely on heterologous expression systems.

What is the role of ResA in the cytochrome c maturation pathway of B. halodurans?

The role of ResA in cytochrome c maturation in B. halodurans likely follows similar principles to the well-characterized system in B. subtilis, with adaptations for alkaline environments:

  • Redox function:
    ResA specifically reduces the cysteine residues in the CXXCH motif of cytochrome c apo-proteins, maintaining them in a reduced state prior to heme attachment . This reduction is crucial as the reaction with heme requires reduced thiols.

  • Integration with ResBC system:
    ResA likely works in concert with ResBC proteins that function as a heme delivery system. The ResBC complex is believed to transport heme across the membrane and present it to the apo-cytochrome in a state conducive to attachment.

  • Regulation by ResDE two-component system:
    Expression of resA is likely regulated by the ResDE two-component system that responds to oxygen limitation, similar to B. subtilis . The ResDE system controls a broader regulon involved in anaerobic respiration, ensuring coordinated expression of cytochrome c and related proteins.

  • Specificity determinants:
    Structural features of ResA determine its substrate specificity. In B. subtilis, a hydrophobic groove adjacent to the active site cysteines has been implicated in substrate recognition . In B. halodurans, this region may contain adaptations that maintain function in alkaline conditions.

  • pH-dependent activity profile:
    As an alkaliphile, B. halodurans likely maintains a cytoplasmic pH less alkaline than its external environment. ResA would need to function in this pH gradient, potentially exhibiting activity optimized for the periplasmic pH of B. halodurans.

Understanding these aspects requires complementary genetic (resA knockout/mutation) and biochemical approaches (in vitro cytochrome c maturation assays with purified components).

How does the redox potential of B. halodurans ResA compare to other thiol-disulfide oxidoreductases?

The redox potential of thiol-disulfide oxidoreductases is a critical determinant of their physiological function. For B. halodurans ResA:

Thiol-disulfide OxidoreductaseOrganismEnvironmentTypical Redox Potential (mV)Function
ResA (predicted)B. haloduransAlkaliphilic, extracellular-160 to -180Reduction of apo-cytochrome c
ResAB. subtilisNeutrophilic, extracellular-256Reduction of apo-cytochrome c
DsbAE. coliNeutrophilic, periplasmic-120Oxidation of protein thiols
DsbAS. aureusNeutrophilic, extracellular-131Oxidation of protein thiols
TrxAB. subtilisNeutrophilic, cytoplasmic-270General disulfide reduction
TrxA (predicted)B. haloduransAlkaliphilic, cytoplasmic-260 to -280General disulfide reduction

The redox potential of B. halodurans ResA would need to be experimentally determined, but it's likely that its value reflects adaptation to the alkaline environment where this organism thrives. The CXXC motif in the active site and adjacent amino acids would be primary determinants of this potential .

Experimental determination typically involves:

  • Direct electrochemical methods

  • Equilibration with redox buffers of known potential

  • Protein-protein equilibration approaches

The redox potential is influenced by pH, so measurements for B. halodurans ResA should be conducted across a pH range (pH 7-10) to understand its function in the alkaliphilic environment. This data would provide insight into whether B. halodurans ResA has evolved a different redox potential from its neutrophilic homologs to maintain function in alkaline conditions.

What structural features determine the pH dependence of B. halodurans ResA activity?

The pH dependence of B. halodurans ResA activity likely stems from several structural features:

  • Active site composition:

    • The pKa values of the active site cysteines are critical determinants of pH-dependent activity

    • Charged residues surrounding the CXXC motif likely modulate these pKa values

    • Comparison with B. subtilis ResA may reveal substitutions that favor activity in alkaline conditions

  • Hydrogen bonding network:

    • The network of hydrogen bonds around the active site influences stability and reactivity

    • pH-dependent changes in protonation states can disrupt or enhance these networks

    • Structural water molecules may play a role in maintaining active site geometry across pH ranges

  • Electrostatic surface potential:

    • Surface charge distribution affects substrate recognition and binding

    • B. halodurans ResA likely has an adapted surface charge distribution compatible with function at high pH

    • Positively charged patches may be reduced compared to neutrophilic homologs

  • Conformational flexibility:

    • pH-dependent structural changes may regulate activity

    • Loop regions near the active site often show pH-responsive movement

    • Molecular dynamics simulations can predict these pH-dependent conformational changes

  • Membrane interaction domains:

    • For membrane-anchored ResA, the interaction with the membrane may be pH-dependent

    • Hydrophobic matching and electrostatic interactions with membrane lipids could be optimized for alkaline environments

Studying these features requires a combination of structural biology techniques (X-ray crystallography, NMR), biophysical characterization methods (circular dichroism to monitor structural changes with pH), and functional assays conducted across a pH range representative of B. halodurans' natural environment.

What methodologies are recommended for analyzing the interaction between ResA and cytochrome c in B. halodurans?

Analyzing the interaction between ResA and apo-cytochrome c requires approaches that capture both the binding event and the subsequent chemical reaction:

  • In vitro reconstitution system:

    • Express and purify both B. halodurans ResA and apo-cytochrome c

    • Establish conditions that prevent spontaneous oxidation of apo-cytochrome thiols

    • Monitor thiol oxidation state using maleimide-based fluorescent probes

    • Quantify the rate of ResA-mediated reduction of apo-cytochrome c

  • Direct binding assays:

    • Surface plasmon resonance (SPR) with immobilized ResA

    • Bio-layer interferometry to measure association/dissociation kinetics

    • Isothermal titration calorimetry for thermodynamic parameters

    • Microscale thermophoresis for solution-based binding measurements

  • Crosslinking approaches:

    • Chemical crosslinking with MS/MS analysis to identify interaction interfaces

    • Photo-crosslinking with artificially incorporated photo-reactive amino acids

    • In vivo crosslinking followed by co-immunoprecipitation to validate physiological relevance

  • Structural studies of the complex:

    • Co-crystallization attempts with substrate-trapping ResA mutants

    • NMR chemical shift perturbation analysis to map interaction surfaces

    • Cryo-EM of the complex, particularly if membrane components are involved

  • Computational approaches:

    • Molecular docking simulations

    • Molecular dynamics of the proposed complex

    • Sequence co-evolution analysis to identify co-evolving residues at the interface

  • Mutagenesis validation:

    • Structure-guided mutagenesis of predicted interface residues

    • Charge-reversal mutations to disrupt electrostatic interactions

    • Complementary mutations in both proteins to restore disrupted interactions

These methodologies should be performed under conditions that mimic the alkaliphilic environment of B. halodurans, typically using buffers at pH 8.5-9.5 with appropriate salt concentrations.

How can researchers troubleshoot expression and activity issues with recombinant B. halodurans ResA?

Common challenges with recombinant ResA and their solutions include:

IssuePotential CausesTroubleshooting Approaches
Low expression yield- Codon bias
- Toxicity
- Protein instability
- Optimize codon usage for expression host
- Use tightly regulated inducible promoters
- Express at lower temperatures (16-25°C)
- Co-express with chaperones
- Use solubility tags (MBP, SUMO)
Inclusion body formation- Rapid overexpression
- Incorrect disulfide formation
- Hydrophobic regions
- Reduce induction strength
- Express in Origami™ or SHuffle® strains
- Add low concentrations of non-ionic detergents
- Attempt refolding from inclusion bodies
Inactive protein- Incorrect folding
- Oxidized active site
- Missing cofactors
- Improper pH
- Ensure reducing conditions during purification
- Test activity across pH range (7.0-10.0)
- Verify protein state by mass spectrometry
- Consider metal ion supplementation
Membrane association issues- Detergent incompatibility
- Incorrect membrane targeting
- Aggregation
- Screen multiple detergent types
- Use nanodisc or liposome reconstitution
- Consider expressing soluble domain only
- Verify membrane targeting with GFP fusions
Substrate specificity problems- Non-native substrates
- Missing interaction partners
- Buffer incompatibility
- Use homologous substrates from B. halodurans
- Co-express with physiological partners
- Optimize buffer composition for alkaliphilic conditions

For activity assays specifically:

  • Ensure buffers are properly adjusted for pH, as B. halodurans proteins may exhibit shifted pH optima

  • Include controls with known active thiol-disulfide oxidoreductases (e.g., E. coli DsbA, B. subtilis ResA)

  • Consider the natural alkaliphilic environment when designing reaction conditions

  • Test activity with both model substrates and physiological substrates

  • Verify the redox state of the active site cysteines before activity measurements

What are the best approaches for studying ResA in the context of the ResDE regulatory system in B. halodurans?

Studying ResA within the ResDE regulatory context requires integrated approaches:

  • Transcriptional regulation analysis:

    • Construct reporter fusions (lacZ, luciferase) to the resA promoter

    • Monitor expression under varying oxygen concentrations

    • Perform electrophoretic mobility shift assays (EMSA) with purified ResD to identify binding sites

    • Conduct DNase I footprinting to precisely map ResD binding sites on the resA promoter

    • Analyze the effect of ResE phosphorylation on ResD binding to the resA promoter

  • ResDE-dependent regulation of resA:

    • Create ResD and ResE deletion or point mutation strains in B. halodurans

    • Analyze resA expression in these backgrounds using RT-qPCR

    • Perform chromatin immunoprecipitation (ChIP) to confirm in vivo binding

    • Compare with known ResDE-dependent genes to identify co-regulated processes

  • Integration with oxygen sensing:

    • Monitor ResA levels and activity under aerobic vs. anaerobic conditions

    • Investigate the impact of different terminal electron acceptors on resA expression

    • Analyze interaction between ResDE and other regulatory systems responding to redox conditions

  • Genetic and biochemical reconstitution:

    • Reconstitute the ResDE-ResA regulatory pathway in a heterologous host

    • Perform in vitro transcription assays with purified ResD~P and RNA polymerase

    • Analyze the dependency of ResD activation on ResE-mediated phosphorylation

  • Systems biology approaches:

    • Perform transcriptomics (RNA-seq) comparing wild-type and resDE mutant strains

    • Integrate with proteomics data to correlate transcript and protein levels

    • Construct regulatory network models including ResDE and downstream targets

These approaches should consider the unique features of B. halodurans, including its adaptation to alkaline environments and potential differences in oxygen metabolism compared to B. subtilis .

How can structure-function studies of B. halodurans ResA inform protein engineering for extreme environments?

Structure-function studies of B. halodurans ResA provide valuable insights for protein engineering:

  • Alkaline adaptation principles:

    • Identify specific residues that confer stability and activity at high pH

    • Compare homologous ResA proteins from neutrophilic and alkaliphilic organisms

    • Map adaptive mutations onto structural models to identify patterns

    • Test chimeric proteins combining domains from different pH-adapted homologs

  • Engineering approaches based on ResA insights:

    • Rational design: Introduce identified alkaliphilic adaptations into non-alkaliphilic proteins

    • Directed evolution: Use B. halodurans ResA as a starting point for evolving enhanced pH tolerance

    • Computational design: Apply principles learned from ResA to design novel alkaline-active enzymes

    • Domain swapping: Create chimeric TDORs with optimized properties

  • Methodological workflow:

    • Structural determination of B. halodurans ResA (X-ray crystallography or cryo-EM)

    • Functional characterization across pH range (7.0-11.0)

    • Molecular dynamics simulations to identify pH-responsive elements

    • Targeted mutagenesis to test hypotheses about alkaline adaptation

    • Activity measurements of engineered variants under extreme conditions

  • Applications in biotechnology:

    • Development of disulfide isomerases for industrial processes at high pH

    • Design of biosensors functional in alkaline environments

    • Creation of biocatalysts for detergent applications

    • Engineering proteins for bioremediation of alkaline waste sites

The unique adaptations in B. halodurans ResA that enable function in alkaline environments represent valuable design principles that can be extracted and applied to other proteins, potentially enabling new applications in extreme conditions .

What insights can comparative genomics provide about the evolution of ResA in alkaliphilic Bacillus species?

Comparative genomics offers rich insights into ResA evolution in alkaliphiles:

  • Phylogenetic analysis across Bacillus species:

    • Construct phylogenetic trees based on ResA sequences from diverse Bacillus species

    • Map habitat pH preferences onto the tree to identify convergent evolution patterns

    • Identify ancestral sequences and potential evolutionary trajectories

    • Calculate selection pressures (dN/dS ratios) on different ResA domains

  • Sequence conservation patterns:

    • Analyze conservation of the CXXC active site motif and variations in XX residues

    • Identify coevolving residue networks specific to alkaliphilic lineages

    • Map conservation onto structural models to identify functionally important regions

    • Compare conservation patterns between membrane-binding and catalytic domains

  • Genome context analysis:

    • Examine genomic organization of resA and related genes across species

    • Identify synteny conservation or rearrangements in alkaliphilic vs. neutrophilic species

    • Analyze promoter regions for ResDE binding sites and other regulatory elements

    • Investigate horizontal gene transfer events that might have contributed to alkaline adaptation

  • Correlation with physiological traits:

    • Compare ResA sequences with growth optima at different pH values

    • Analyze correlation between ResA variants and cytochrome c content/types

    • Investigate relationship between ResA evolution and respiratory versatility

    • Examine co-evolution with ResBC and other cytochrome c maturation components

This comparative approach can reveal whether alkaliphilic adaptations in ResA evolved once or multiple times, identify key mutations that enabled alkaline tolerance, and provide insight into the molecular mechanisms of adaptation to extreme environments .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.