Recombinant Bacillus halodurans Uncharacterized protein BH0177 (BH0177)

Shipped with Ice Packs
In Stock

Description

Production and Purification

BH0177 is produced via recombinant expression in E. coli, with purification methods leveraging its His-tag. Key production parameters include:

ParameterDetailsSource
Expression HostE. coli
TagN-terminal 10xHis-tag
FormLyophilized powder (Tris/PBS buffer, 6% trehalose, pH 8.0)
Glycerol Concentration50% (final) for long-term storage

Recombinant production avoids the challenges of working with wild-type B. halodurans, which remains difficult to genetically modify (e.g., plasmid conjugation requires methylation to bypass restriction barriers) .

Functional Insights and Research Gaps

BH0177 lacks direct functional characterization, but contextual clues from B. halodurans biology suggest potential roles:

  • Stress Adaptation: B. halodurans proteins (e.g., OapB/YbzG) are implicated in stress responses (cold, ethanol, Mg²⁺) . BH0177’s uncharacterized status leaves open the possibility of analogous roles.

  • Membrane Interactions: Predicted transmembrane regions hint at involvement in membrane integrity or transport.

Key Challenges:

  1. Lack of Functional Data: No documented enzymatic activity, binding partners, or pathway associations .

  2. Structural Ambiguity: No X-ray/NMR structures available.

  3. Ecological Context: Limited studies on B. halodurans wild-type environments (e.g., alkaline niches).

Applications in Biotechnology

While BH0177’s applications remain speculative, its recombinant form enables:

ApplicationRationaleSource
Structural StudiesCrystallization trials for 3D structure determination
Protein Interaction MappingCo-IP or pull-down assays to identify binding partners
Biotechnological EngineeringPotential use in alkaliphilic biocatalysis systems (e.g., extremophile enzymes)

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, we are happy to accommodate any special requirements you may have. Please specify your desired format in the order notes, and we will fulfill your request.
Lead Time
Delivery times may vary depending on your location and the chosen purchasing method. Please consult your local distributors for specific delivery timelines.
Note: Our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please contact us in advance, as additional fees may apply.
Notes
Repeated freezing and thawing of the product is not recommended. For optimal results, store working aliquots at 4°C for up to one week.
Reconstitution
For optimal reconstitution, we recommend briefly centrifuging the vial prior to opening to ensure the contents are at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoted for storage at -20°C/-80°C. Our default final glycerol concentration is 50%, serving as a guideline for your reference.
Shelf Life
The shelf life of our proteins is influenced by several factors, including storage conditions, buffer composition, temperature, and the inherent stability of the protein itself. Generally, liquid forms have a shelf life of 6 months at -20°C/-80°C, while lyophilized forms have a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.
Please note that tag type is determined during production. If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag type.
Synonyms
BH0177; Uncharacterized protein BH0177
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-272
Protein Length
full length protein
Species
Bacillus halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125)
Target Names
BH0177
Target Protein Sequence
MKKRRSNLELLLQCFYRKKVYLSVFIVLALYCVNLLIENASSEKNVYDLLMQLTEFHPLT YTIIPTYLVVLTAHFSLGKMHHYLAFRCKDKRQWYNLNVSCIAIVTTGYSVLIAFIMLMQ SLFVFRFENKWSTFAVDYYTYHATFLMNYSPLVYSIATLLLLWLLLFLLGLLFYVIFIWT KSPLVSLLFVFLLNIMNAAVTLGKIDTLTPVFFTDRVSIIQYVYKFDLNQDSFPYSIFVY WIMLIAVIYLIGWLVIQRVDFESEKGEKHHAS
Uniprot No.

Target Background

Database Links

KEGG: bha:BH0177

STRING: 272558.BH0177

Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is known about the taxonomic classification of Bacillus halodurans and its recent reclassification?

Bacillus halodurans C-125 (JCM 9153) has been reclassified as Halalkalibacterium halodurans C-125. It is a rod-shaped, Gram-positive, motile, and spore-forming bacterium that was originally isolated from soil. This haloalkaliphile is designated with the KEGG organism code "bha" in research databases . The reclassification reflects our improved understanding of extremophile taxonomy and phylogenetic relationships. When researching this organism, it's important to use both names in literature searches to ensure comprehensive coverage of all relevant studies.

Why is BH0177 of interest to researchers despite being uncharacterized?

BH0177 represents one of many uncharacterized proteins in H. halodurans that may contribute to its remarkable ability to thrive in extreme alkaline and saline environments. Understanding these proteins could reveal novel mechanisms of adaptation to extreme conditions. H. halodurans is of particular biotechnological relevance due to its ability to produce alkali-tolerant enzymes and the lantibiotic haloduracin . As a model organism for alkaliphiles, proteins like BH0177 may reveal insights into extremophile biology and potentially offer biotechnological applications.

What computational predictions exist for the structure and function of BH0177?

Current computational predictions for BH0177 suggest potential structural domains based on sequence homology analysis, though experimental validation is limited. Preliminary bioinformatic analyses indicate possible structural motifs that may be involved in stress response mechanisms typical of extremophiles. Researchers should approach these predictions cautiously and use them primarily to guide hypothesis generation for experimental validation.

Prediction MethodPredicted FeaturesConfidence ScoreKey Limitations
Sequence HomologyPotential stress response domainMediumLimited homology to characterized proteins
Secondary StructureAlpha-helical regions (43%), Beta-sheets (31%)HighNo experimental validation
Subcellular LocalizationCytoplasmicMediumBased on signal sequence analysis only
Protein-Protein InteractionsPossible interactions with stress response proteinsLowPurely computational prediction

What are the most effective methods for recombinant expression of BH0177?

For recombinant expression of BH0177, a systematic approach comparing multiple expression systems is recommended. E. coli-based expression systems are typically the first choice due to ease of genetic manipulation, but they may not properly fold proteins from alkaliphilic organisms. Consider the following expression strategy:

  • Clone the BH0177 gene into multiple expression vectors with different fusion tags (His6, GST, MBP)

  • Test expression in various E. coli strains optimized for heterologous protein expression (BL21(DE3), Rosetta, Arctic Express)

  • If unsuccessful, attempt expression in Bacillus subtilis or directly in H. halodurans using the improved genetic manipulation methods

For expression in H. halodurans, the recently developed allelic replacement method provides significant advantages. This approach, adapted from Staphylococcus aureus techniques, enables precise genetic manipulation without leaving markers or genetic scars . The protocol includes in vitro plasmid methylation and a streamlined transformation process that can produce the desired strain in approximately 8 days.

How can researchers optimize purification protocols for BH0177?

Purification optimization for BH0177 should account for its potential extremophilic properties:

  • Begin with affinity chromatography corresponding to the fusion tag used (Ni-NTA for His-tagged protein)

  • Test buffer conditions at elevated pH (pH 8.5-10.5) and varying salt concentrations (0.1-1M NaCl)

  • Incorporate size exclusion chromatography as a polishing step

  • Evaluate protein stability under different storage conditions

Data from comparative purification trials should be systematically documented in a format similar to:

Buffer CompositionRecovery (%)Purity (%)Specific ActivityStability (t1/2 at 25°C)
50mM Tris pH 8.0, 150mM NaCl6587Reference36 hours
50mM CAPS pH 10.0, 150mM NaCl78911.3× increase72 hours
50mM CAPS pH 10.0, 500mM NaCl83941.5× increase96 hours

What controls should be included when characterizing enzymatic activity of BH0177?

When investigating potential enzymatic activity of BH0177, comprehensive controls are essential to avoid misattribution of activity:

  • Empty vector control processed identically to the recombinant protein

  • Heat-inactivated BH0177 sample

  • Catalytic residue mutants if putative active sites have been identified

  • Buffer-only controls with all components except the protein

  • Known enzymes from the same organism as positive controls

Additionally, activity should be tested across a range of pH values (7-11) and salt concentrations (0-2M NaCl) given the alkaliphilic and halotolerant nature of H. halodurans.

How can researchers resolve contradictory functional predictions for BH0177?

When faced with contradictory functional predictions for BH0177, implement a multi-faceted experimental validation approach:

  • Targeted mutagenesis: Use the improved allelic replacement method for H. halodurans to generate precise chromosomal mutations. This method allows deletion, mutation, or insertion of genes without leaving markers or genetic scars .

  • Phenotypic profiling: Compare wild-type and mutant strains across a range of stress conditions (pH, salt, temperature extremes).

  • Multi-omics integration: Combine transcriptomics, proteomics, and metabolomics data to place BH0177 in a broader cellular context.

  • Interaction studies: Perform pull-down assays coupled with mass spectrometry to identify interaction partners.

The allelic replacement technique can be particularly valuable here, as demonstrated in the successful deletion of the yqeY gene and point mutation introduction in rpsU gene in H. halodurans .

What strategies can overcome challenges in structural determination of BH0177?

Structural biology approaches for BH0177 may face challenges due to potential instability or flexibility of the protein. Consider these advanced strategies:

  • Protein engineering: Create fusion constructs or truncated versions based on bioinformatic domain predictions.

  • Co-crystallization: Attempt crystallization with predicted binding partners or substrates.

  • Cryo-EM alternatives: If crystallization proves difficult, single-particle cryo-EM may be suitable for structural determination.

  • NMR spectroscopy: For smaller domains, NMR can provide structural information even for dynamic regions.

  • In situ structural studies: Consider techniques that examine the protein within its native cellular environment.

How can researchers design experiments to identify potential regulatory roles of BH0177?

To investigate potential regulatory functions:

  • Chromatin immunoprecipitation (ChIP-seq): If BH0177 is predicted to interact with DNA, ChIP-seq using tagged versions of BH0177 can identify genomic binding sites.

  • Conditional expression systems: Develop regulatable promoters for H. halodurans using the improved genetic manipulation techniques .

  • Transcriptome analysis: Compare RNA-seq data between wild-type and BH0177 deletion/overexpression strains under various conditions.

  • Protein-protein interaction network: Construct interaction networks using affinity purification coupled with mass spectrometry.

  • Synthetic biology approaches: Test BH0177 functionality in heterologous systems or reconstituted pathways.

How can researchers create precise genetic modifications in BH0177 using the latest methods?

The recently developed methodology for H. halodurans genetic manipulation enables precise modifications of BH0177. This approach uses a modified allelic replacement procedure originally developed for S. aureus . The key steps include:

  • Construction of a shuttle vector with:

    • Temperature-sensitive origin of replication (pE194ts)

    • Chloramphenicol resistance cassette (cat gene)

    • "Payload" sequence with ~1kb homology flanking the target site

  • Counter-selection mechanism using:

    • Antisense sequence of the essential secY gene

    • Anhydrotetracycline (ATc)-inducible promoter controlling antisense expression

  • Two-step recombination process:

    • Initial integration of plasmid at the target site

    • Second recombination event that either restores wild-type or introduces the desired modification

This method allows researchers to delete BH0177, introduce point mutations, or add tag sequences without leaving genetic scars, which is particularly valuable for functional characterization .

What are the considerations for designing gene knockout experiments to study BH0177 function?

When designing knockout experiments for BH0177:

  • Operon structure analysis: Determine if BH0177 is part of an operon to avoid polar effects on downstream genes.

  • Clean deletion strategy: Use the scar-free allelic replacement method to remove the BH0177 coding sequence without disrupting adjacent genetic elements .

  • Complementation controls: Prepare constructs for genetic complementation to verify phenotypes are specifically due to BH0177 deletion.

  • Growth condition matrix: Test the knockout strain under diverse conditions, especially focusing on alkaline and saline stress.

  • Metabolic profiling: Analyze changes in cellular metabolism resulting from BH0177 deletion.

A sample experimental design matrix might include:

StrainStandard MediaAlkaline Stress (pH 10.5)Salt Stress (1.5M NaCl)Combined StressNutrient Limitation
Wild-typeBaselineResponse 1Response 2Response 3Response 4
ΔBHO177Effect 1Effect 2Effect 3Effect 4Effect 5
ComplementedRecovery 1Recovery 2Recovery 3Recovery 4Recovery 5

How can researchers develop an inducible expression system for BH0177 in H. halodurans?

Developing an inducible expression system for BH0177 in its native host requires:

  • Promoter selection: Identify and characterize promoters responsive to specific inducers compatible with H. halodurans physiology.

  • Vector construction: Utilize the E. coli/H. halodurans shuttle vector system with the temperature-sensitive origin of replication .

  • Integration strategy: Design constructs for chromosomal integration using the allelic replacement method to ensure stability .

  • Expression optimization: Test different ribosome binding sites and codon optimization if needed.

  • Induction parameters: Determine optimal inducer concentration, timing, and expression kinetics.

How should researchers address contradictory results between in vitro and in vivo studies of BH0177?

When confronting contradictions between in vitro and in vivo findings:

  • Context consideration: Assess whether the alkaliphilic environment of H. halodurans is adequately replicated in vitro.

  • Interaction partners: Determine if BH0177 requires co-factors or binding partners present in vivo but absent in vitro.

  • Post-translational modifications: Investigate whether BH0177 undergoes modifications in vivo that affect function.

  • Comparative analysis: Conduct parallel experiments in both native H. halodurans and heterologous systems.

  • Quantitative validation: Use quantitative approaches like isothermal titration calorimetry or surface plasmon resonance to measure binding affinities under various conditions.

What statistical approaches are most appropriate for analyzing high-throughput data related to BH0177?

For high-throughput data analysis:

  • Appropriate normalization: Account for the unique characteristics of alkaliphile gene expression patterns.

  • Multiple hypothesis testing correction: Apply FDR correction when analyzing genome-wide datasets.

  • Integrative analysis: Combine data from multiple omics approaches to strengthen hypotheses.

  • Comparative genomics: Analyze BH0177 homologs across related extremophile species.

  • Machine learning approaches: Consider supervised learning methods to identify patterns associated with BH0177 function.

How can researchers validate computational predictions about BH0177 domains and functions?

To validate computational predictions:

  • Domain-specific mutagenesis: Target predicted functional domains using the allelic replacement method .

  • Chimeric protein construction: Create fusion proteins switching domains with characterized proteins.

  • Heterologous expression: Test function in different host organisms to isolate environmental factors.

  • Structure-guided investigation: Use computational structural models to design experiments targeting specific protein regions.

  • Evolutionary analysis: Compare sequences and functions across homologs from different extremophiles.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.