Recombinant Bacillus halodurans UPF0295 protein BH0952 (BH0952)

Shipped with Ice Packs
In Stock

Product Specs

Form
Supplied as a lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for fulfillment according to your requirements.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Our proteins are shipped with standard blue ice packs. Dry ice shipping requires advance notification and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If a specific tag type is required, please inform us, and we will prioritize its development.
Synonyms
BH0952; UPF0295 protein BH0952
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-121
Protein Length
full length protein
Species
Bacillus halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125)
Target Names
BH0952
Target Protein Sequence
MGIKYSNKINKIRTFALSLVFLGILVMYIGIFFRTHEVIMVLAMILGFLCIIASTAVYFW IGMISTRAIPVVCPECGKPTKVLGRVDACMHCDQPLTLDRSLEGKEFDEKYNLKGKKRVD G
Uniprot No.

Target Background

Database Links

KEGG: bha:BH0952

STRING: 272558.BH0952

Protein Families
UPF0295 family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is BH0952 and what are its basic characteristics?

BH0952 is a protein encoded by the Bacillus halodurans C-125 genome, classified as a UPF0295 family protein. It is a relatively small protein consisting of 121 amino acids . B. halodurans is a rod-shaped, Gram-positive, motile, and spore-forming bacterium typically found in soil, with notable adaptations to alkaline environments. The organism has been reclassified taxonomically, with the current nomenclature being Alkalihalobacillus halodurans .

The BH0952 protein is part of the 4,066 protein-coding genes identified in the 4.2 Mbp B. halodurans genome . While specific functions of BH0952 have not been fully characterized, its study is relevant to understanding protein function in extremophilic bacteria.

What expression systems are recommended for recombinant BH0952 production?

For recombinant expression of BH0952, E. coli-based expression systems have proven effective, particularly when using vectors that incorporate a polyhistidine tag for subsequent purification .

Recommended methodology for expression:

  • Clone the BH0952 gene into an expression vector containing a His-tag (such as pMCSG7, which includes an N-terminal polyhistidine tag followed by a tobacco etch virus (TEV) protease recognition site)

  • Transform into an appropriate E. coli strain (BL21(DE3) is commonly used)

  • Culture in either rich media (LB) or minimal media (M9) as follows:

    • Grow at 37°C with agitation at 200 rpm until OD600 = 0.5

    • Induce with 1 mM IPTG

    • Incubate overnight (approximately 16 hours) at lower temperature (20°C for LB cultures and 30°C for M9 cultures)

This approach ensures good protein expression while reducing the formation of inclusion bodies. For expression in the native organism, methylation of the plasmid may be necessary to overcome restriction-modification barriers .

How can I verify successful expression of BH0952?

Verification of successful expression requires multiple analytical approaches:

  • SDS-PAGE Analysis: Prepare samples as follows:

    • Collect induced cells equivalent to 1 ml at OD600 = 3

    • Centrifuge and resuspend in 50 μl of 0.1 M Tris/HCl, pH 8.0

    • Add 50 μl solubilization buffer (6% SDS, 1 M dithiothreitol, 0.06% bromophenol blue, 20% sucrose)

    • Heat at 90°C for 5 minutes

    • Cool and dilute with 200 μl 0.1 M Tris buffer

    • Analyze 25 μl on a 4-20% gradient polyacrylamide gel

  • Western Blot: Using anti-His antibodies for tagged protein detection

  • PCR Verification: For recombinant strains, perform colony PCR using appropriate primers targeting the insert region to verify genetic incorporation

Expected outcome: A band corresponding to approximately 15 kDa (varying slightly depending on the expression construct and tags used).

What is the optimal purification method for His-tagged BH0952?

Immobilized Metal Affinity Chromatography (IMAC) is the recommended method for purifying His-tagged BH0952. The following protocol utilizes HisLink™ Resin for gravity-flow column chromatography :

Materials Required:

  • HisLink™ Protein Purification Resin

  • HEPES buffer (pH 7.5)

  • Imidazole

  • HisLink™ Binding Buffer

  • HisLink™ Wash Buffer

  • HisLink™ Elution Buffer

  • Chromatography column

Procedure:

  • Cell Lysis:

    • Use sonication, French press, or commercial reagents like FastBreak™ Cell Lysis Reagent

    • Add protease inhibitors (1 mM PMSF) to prevent degradation

    • Add DNase and RNase (up to 20 μg/ml) to reduce lysate viscosity

    • If using lysozyme, add >300 mM NaCl to binding and wash buffers

  • Column Preparation:

    • Equilibrate resin with five column volumes of binding buffer

  • Sample Application:

    • Add cleared lysate to the column at a flow rate not exceeding 1-2 ml/minute per ml of column volume

    • Do not allow the resin to dry after applying the lysate

  • Washing:

    • Wash with 10-20 column volumes of wash buffer, divided into 2-3 aliquots

  • Elution:

    • Add elution buffer and collect 0.5-5 ml fractions

    • BH0952 typically elutes in the first 1 ml, with complete elution after 3-5 ml of buffer per 1 ml of resin

For higher purity, a two-step IMAC purification process can be employed:

  • Initial IMAC purification

  • TEV protease treatment to cleave the His-tag

  • Second IMAC step to remove TEV protease, uncleaved protein, and contaminants

How can I assess the purity and yield of purified BH0952?

Multiple analytical methods should be used in combination:

  • SDS-PAGE Analysis:

    • Compare aliquots from different purification steps on a 4-20% gradient gel

    • Pure BH0952 should appear as a single dominant band at the expected molecular weight

    • Quantify band intensity using densitometry for relative purity assessment

  • Protein Concentration Determination:

    • Bradford or BCA assay for total protein concentration

    • Absorbance at 280 nm using the calculated extinction coefficient for BH0952

  • Size Exclusion Chromatography:

    • Analytical SEC can reveal the presence of aggregates, oligomers, or contaminants of different sizes

  • Mass Spectrometry:

    • MALDI-TOF or ESI-MS to confirm the correct mass and identity of the purified protein

    • Tryptic digest followed by LC-MS/MS for sequence coverage analysis

Expected yield varies depending on expression conditions but typically ranges from 5-15 mg of purified protein per liter of bacterial culture for small proteins like BH0952.

What are the best storage conditions for maintaining BH0952 stability?

To maximize stability of purified BH0952:

  • Short-term storage (1-2 weeks):

    • Store at 4°C in a buffer containing:

      • 50 mM Tris-HCl or HEPES, pH 7.5-8.0

      • 150 mM NaCl

      • 1-5 mM DTT or 0.5-1 mM TCEP (to prevent oxidation)

      • Optional: 10% glycerol

  • Long-term storage:

    • Flash-freeze aliquots by dripping into liquid nitrogen

    • Store at -80°C

    • Avoid repeated freeze-thaw cycles

  • For crystallization purposes:

    • Concentrate to ≥5 mg/ml in a minimal buffer (e.g., 10-20 mM HEPES, 50-100 mM NaCl)

    • Remove reducing agents if they interfere with crystallization screens

    • Filter through a 0.22 μm filter before setting up crystallization trials

Monitor protein stability using analytical size exclusion chromatography or dynamic light scattering before and after storage to detect aggregation or degradation.

What are the challenges in genetic manipulation of B. halodurans for native expression of modified BH0952?

Genetic manipulation of B. halodurans presents several challenges that require specialized approaches:

  • Restriction-Modification Barriers:

    • B. halodurans possesses restriction-modification systems that degrade foreign DNA

    • Solution: In vivo or in vitro methylation of plasmid DNA before transformation

  • Inefficient Transformation:

    • Traditional transformation methods often yield low efficiency

    • Solution: Use conjugational transformation and an improved allelic replacement method originally developed for Staphylococcus aureus

  • Plasmid Stability:

    • Maintaining stable plasmids in B. halodurans can be difficult

    • Solution: Use shuttle vectors with appropriate selection markers and temperature-sensitive origins of replication

  • Lack of Competence:

    • B. halodurans lacks some genes necessary for natural competence (comS, srfA, rapC)

    • Solution: Use electroporation or conjugation methods rather than attempting natural transformation

The allelic replacement technique for B. halodurans involves:

  • A shuttle vector with temperature-sensitive origin of replication (pE194ts)

  • A chloramphenicol resistance cassette (cat gene)

  • "Payload" sequences with ~1 kb homology flanks for targeted genomic modifications

  • An antisense secY sequence regulated by an anhydrotetracycline-inducible promoter for counter-selection

How does the native B. halodurans environment affect BH0952 expression and function?

B. halodurans thrives in alkaline environments, which has implications for protein expression and function:

  • pH Adaptation:

    • B. halodurans contains unique genes and sigma factors that aid adaptation to alkaline environments

    • These adaptations may influence protein folding, stability, and function

    • Native BH0952 is likely optimized for function in alkaline conditions

  • Expression Conditions:

    • For native expression, use Horikoshi medium (pH 9) with appropriate antibiotics if using recombinant strains

    • Growth curves differ between wild-type and recombinant B. halodurans strains, with recombinants typically showing slower growth

  • Post-translational Modifications:

    • B. halodurans may have specific post-translational modification systems not present in E. coli

    • These modifications may be crucial for proper BH0952 function

  • Co-factor Requirements:

    • If BH0952 requires co-factors, these may be more readily available in the native host

    • When expressing in heterologous systems, supplementation may be necessary

When studying BH0952 function, consider comparing properties of the protein expressed in both native B. halodurans and heterologous hosts to identify environment-dependent characteristics.

What computational approaches can predict BH0952's structure and function?

Several computational methods can provide insights into BH0952 structure and function:

  • Homology Modeling:

    • Use tools like SWISS-MODEL, Phyre2, or AlphaFold2

    • Identify structural homologs in the PDB using HHpred

    • Evaluate model quality using MolProbity, ProSA, and QMEAN

  • Sequence Analysis:

    • Multiple sequence alignment with UPF0295 family proteins

    • Conservation analysis to identify functionally important residues

    • Analysis of surrounding genomic context for functional associations

  • Structural Feature Prediction:

    • Secondary structure prediction (PSIPRED, JPred)

    • Disorder prediction (DISOPRED, IUPred)

    • Binding site prediction (3DLigandSite, CASTp)

    • Transmembrane region prediction (TMHMM, Phobius)

  • Functional Prediction:

    • Gene Ontology term prediction (DeepGOPlus)

    • Enzyme classification prediction (ECPred)

    • Protein-protein interaction prediction (STRING database)

    • Metabolic pathway analysis (KEGG, BioCyc)

For BH0952, comparative analysis with its homologs in other Bacillus species (especially B. subtilis) may provide functional insights, given that 8.8% of B. halodurans CDSs match sequences found only in B. subtilis and 66.7% are widely conserved .

What experimental approaches are recommended to determine BH0952's function?

A multi-pronged experimental strategy is recommended:

  • Structural Analysis:

    • X-ray crystallography: Screen using Hampton screen kits, with appropriate cryoprotectant for diffraction analysis

    • NMR spectroscopy for solution structure (appropriate for smaller proteins like BH0952)

    • Cryo-EM for structural complexes if BH0952 forms larger assemblies

  • Biochemical Characterization:

    • Enzymatic activity assays based on predicted function

    • In vitro protein-protein interaction assays (pull-down, SPR, ITC)

    • Substrate binding studies

    • Thermal stability analysis (DSF, CD spectroscopy)

  • Genetic Approaches:

    • Gene knockout using allelic replacement method

    • Phenotypic analysis of knockout strains

    • Complementation studies

    • Suppressor screening

  • Transcriptomic/Proteomic Analysis:

    • RNA-Seq of knockout strains vs. wild-type

    • Differential proteomics

    • Metabolomic profiling

  • Localization Studies:

    • GFP fusion proteins

    • Immunolocalization

    • Cell fractionation

When selecting methods, consider the hypotheses derived from computational analyses and start with the most promising approaches to efficiently narrow down the potential functions.

How should I design experiments to overcome data analysis challenges when working with BH0952?

When designing experiments involving BH0952, several strategies can optimize data quality and analysis:

  • Experimental Design Principles:

    • Apply principles of optimal experimental design for efficient data collection

    • Use retrospective designed sampling to improve analysis of large datasets

    • Select training samples that have generally "good" properties (balance, orthogonality)

  • Control Experiments:

    • Include appropriate negative controls (e.g., empty vector, inactive mutants)

    • Use positive controls from related proteins with known function

    • Implement biological and technical replicates (minimum n=3)

  • Sequential Experimentation:

    • Design experiments in stages, with each stage informed by previous results

    • For structural studies, use a hierarchical approach (prediction → low-resolution → high-resolution)

  • Algorithm Application:

  • Statistical Approach:

    • For complex data, consider Bayesian approaches with Sequential Monte Carlo (SMC) algorithms

    • Use importance sampling to approximate utility functions

    • Apply appropriate model validation techniques (cross-validation, bootstrap)

The above approaches will help in efficiently designing experiments that generate high-quality data and overcome challenges in analyzing results for BH0952, which may have subtle or complex functional characteristics.

What strategies should I use when facing contradictory results in BH0952 functional studies?

When confronted with contradictory results in BH0952 functional studies, a systematic troubleshooting approach is essential:

  • Methodological Verification:

    • Validate protein identity via mass spectrometry

    • Confirm protein folding using circular dichroism or fluorescence spectroscopy

    • Assess experimental conditions (pH, temperature, buffer composition) that might affect function

  • Cross-Validation Approaches:

    • Apply orthogonal methods to test the same hypothesis

    • Test function in different expression systems (E. coli vs. B. halodurans)

    • Use both in vitro and in vivo assays

  • Investigate Potential Confounding Factors:

    • Protein tags influence on function

    • Post-translational modifications

    • Co-factor dependencies

    • Interaction partners present in one system but not another

  • Construct Structure-Function Relationship:

    • Create site-directed mutants of key residues

    • Test truncated versions to identify functional domains

    • Analyze chimeric proteins with related family members

  • Decision Matrix for Contradictory Results:

    Contradiction TypeInvestigation StrategyResolution Approach
    Activity present in one buffer but not anotherSystematic buffer screen varying pH, salt, additivesIdentify optimal conditions for activity
    Function in native host but not E. coliTest methylated or codon-optimized constructsExpression with co-factors or chaperones
    Computational prediction contradicts experimental dataEvaluate prediction confidence, test alternative modelsRefine computational model with experimental constraints
    Phenotype in knockout differs from in vitro activityCheck for compensatory mechanisms, redundant functionsConstruct double/triple knockouts of related genes
    Structural data doesn't explain functional resultsLook for conformational changes, allosteric sitesSolve structure in different conditions or bound states

Remember that contradictions often lead to the most interesting discoveries about protein function and can reveal unexpected aspects of BH0952 biology.

How can I develop a research program to fully characterize BH0952's role in B. halodurans biology?

A comprehensive research program for BH0952 characterization should encompass:

  • Phase I: Basic Characterization (0-12 months)

    • Recombinant expression and purification optimization

    • Preliminary structural analysis (CD spectroscopy, limited proteolysis)

    • Bioinformatic analysis and initial functional predictions

    • Generation of knockout strain

  • Phase II: Functional Investigation (12-24 months)

    • High-resolution structural analysis (X-ray/NMR)

    • Systematic biochemical activity assays

    • Transcriptomic/proteomic comparison of knockout vs. wild-type

    • Phenotypic characterization under various growth conditions

  • Phase III: Biological Context (24-36 months)

    • Protein-protein interaction network mapping

    • Metabolic impact analysis

    • In vivo localization and dynamics

    • Evolutionary analysis across related species

  • Phase IV: Integration and Application (36+ months)

    • Systems biology modeling of BH0952 role

    • Engineering applications based on discovered functions

    • Comparative analysis with homologs from other extremophiles

Sample Research Timeline:

TimeframeKey QuestionsMethodologiesExpected Outcomes
0-6 monthsCan we obtain pure, active BH0952?Optimization of expression/purification protocolsStandardized production protocol
6-12 monthsWhat is BH0952's structure? What happens when BH0952 is absent?Structure determination; knockout generationInitial structure; viable knockout strain
12-18 monthsWhat molecules does BH0952 interact with?Binding assays; co-IP; metabolite screeningIdentification of binding partners
18-24 monthsHow does BH0952 respond to environmental changes?Expression analysis under varied conditionsRegulatory understanding
24-30 monthsWhat is the minimal functional unit of BH0952?Domain analysis; fragment activity testingFunctional domain map
30-36 monthsHow is BH0952 integrated into cellular pathways?Systems biology approaches; network analysisPathway models

This structured approach ensures comprehensive characterization while building on preceding discoveries to guide subsequent experimental directions.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.