Recombinant Bacillus halodurans UPF0365 protein BH1357 (BH1357)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Consult your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, offered as a guideline for customers.
Shelf Life
Shelf life depends on storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us for preferential development.
Synonyms
floA; BH1357; Flotillin-like protein FloA
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-331
Protein Length
full length protein
Species
Bacillus halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125)
Target Names
BH1357
Target Protein Sequence
MPVDLGLIILLGVIFIALAVLFTFVPVGLWISALAAGVKIGIFELVGMRLRRVIPRRVVE PLIKAVKAGLDLSTSKLEGHYLAGGNVDRVVNALIAAQRANIDLSFERCAAIDLAGRDVL QAVQMSVNPKVIETPFIAGVAMDGIEVKAKARITVRANIDRLVGGAGEETVIARVGEGIV STIGSSDDHKKVLENPDTISQTVLKKGLDAGTAFEILSIDIADIDIGKNIGAGLQTDQAE ADKKIAQAKAEERRAMAVAKEQEMRAKVEEMRAKVVEAEAEVPMALSDALRKGNMGVMDY LNYQNVMADTDMRDSISKATGDQEADEKNDR
Uniprot No.

Target Background

Function

Found in functional membrane microdomains (FMMs), potentially equivalent to eukaryotic membrane rafts. FMMs exhibit high dynamism and increase in number with cellular aging. Flotillins are believed to play a significant role in regulating membrane fluidity.

Database Links

KEGG: bha:BH1357

STRING: 272558.BH1357

Protein Families
UPF0365 family
Subcellular Location
Cell membrane; Multi-pass membrane protein. Membrane raft; Multi-pass membrane protein.

Q&A

How is Recombinant BH1357 typically produced for research applications?

Recombinant BH1357 is typically produced using E. coli expression systems with an N-terminal His-tag for purification purposes. The full-length protein (amino acids 1-331) is cloned into an appropriate expression vector, transformed into E. coli, and expression is induced under optimized conditions. The protein is then purified using affinity chromatography, typically employing Ni-NTA columns that bind the His-tag .

For optimal production, the methodology includes:

  • Selection of an appropriate E. coli strain compatible with membrane protein expression

  • Culture in rich media with controlled induction parameters

  • Cell lysis under conditions that maintain protein stability

  • Affinity purification steps followed by optional tag removal

  • Quality control by SDS-PAGE to ensure >90% purity

What are the optimal storage conditions for Recombinant BH1357 to maintain functionality?

The optimal storage conditions for Recombinant BH1357 involve a multi-tiered approach depending on usage timeline:

Storage PeriodRecommended ConditionsBuffer Composition
Long-term storage-20°C to -80°CTris-based buffer with 50% glycerol
Extended experiments-20°CTris/PBS-based buffer with 6% Trehalose, pH 8.0
Working solutions4°CSame as stock, for up to one week

To maintain protein integrity, it's crucial to avoid repeated freeze-thaw cycles as this can significantly compromise structural integrity and biological activity. For extended storage, aliquoting the protein into single-use volumes is strongly recommended .

When reconstituting lyophilized protein, researchers should use deionized sterile water to achieve a concentration of 0.1-1.0 mg/mL, followed by the addition of glycerol (final concentration 50%) for storage stability .

How should I design experiments to characterize the function of BH1357 when its precise role is not well-established?

When characterizing proteins of unknown function like BH1357, a systematic experimental approach is essential:

  • Sequence-based predictions: Begin with bioinformatic analysis to identify conserved domains, potential transmembrane regions, and similar characterized proteins. For BH1357, note its classification as a UPF0365 family protein and potential flotillin-like properties .

  • Expression analysis: Determine natural expression conditions in Bacillus halodurans using qRT-PCR under various growth conditions (pH variations, temperature stress, osmotic stress).

  • Localization studies: Employ GFP fusion constructs to determine subcellular localization, which can provide functional insights. For membrane proteins like BH1357, confocal microscopy with appropriate membrane markers is recommended.

  • Interactome mapping: Identify protein interaction partners using:

    • Pull-down assays with the His-tagged recombinant protein

    • Bacterial two-hybrid systems

    • Co-immunoprecipitation followed by mass spectrometry

  • Loss-of-function studies: Create knockout strains and assess phenotypic changes across multiple growth conditions.

Document your experimental design following established protocols with clear identification of:

  • Independent variables (e.g., growth conditions, interaction partners)

  • Dependent variables (e.g., expression levels, localization patterns)

  • Appropriate controls for each experiment

What controls should be included when studying protein-protein interactions involving BH1357?

When investigating protein-protein interactions with BH1357, robust controls are essential to ensure reliable results:

  • Negative controls:

    • Empty vector controls in pull-down assays

    • Unrelated proteins with similar size/charge properties

    • Non-specific tag-only controls to identify false positives due to tag-mediated interactions

  • Positive controls:

    • Known protein-protein interactions from the same organism

    • Artificially designed interacting proteins when studying new interaction domains

  • Specificity controls:

    • Competitive binding assays with unlabeled proteins

    • Truncated versions of BH1357 to map interaction domains

    • Site-directed mutagenesis of predicted interaction sites

  • Technical validation controls:

    • Reciprocal co-immunoprecipitation

    • Multiple detection methods (e.g., western blot, mass spectrometry)

    • Concentration gradients to establish binding kinetics

When designing these experiments, follow established experimental design principles including multiple biological replicates, randomization, and appropriate blinding procedures where applicable .

How can I develop a cell-free system to study BH1357 functional properties?

Developing a cell-free system for studying BH1357 requires careful consideration of protein characteristics and research objectives:

  • Extraction method optimization:

    • For membrane proteins like BH1357, use detergent-based extraction methods (e.g., n-Dodecyl β-D-maltoside or CHAPS)

    • Alternatively, reconstitute purified BH1357 into liposomes or nanodiscs to maintain native membrane environment

  • Buffer composition optimization:

    • Test various buffer systems (HEPES, Tris, Phosphate) at different pH values (6.5-8.5)

    • Optimize salt concentrations (typically 100-300 mM NaCl or KCl)

    • Include stabilizing agents like glycerol (10-20%) or specific lipids

  • Activity assays:

    • If BH1357 has potential binding activity, develop fluorescence-based binding assays

    • For potential enzymatic activity, design appropriate substrate-based assays

    • Consider protein-protein interaction studies using label-free technologies

Draw inspiration from established cell-free systems like the HEK293 cell-extract deadenylation assay described in the literature, which provides a template for studying protein-RNA interactions .

How can structural biology approaches be applied to elucidate BH1357 function?

Elucidating the structure of BH1357 requires multiple complementary approaches due to its membrane protein characteristics:

  • X-ray crystallography workflow:

    • Expression optimization to generate milligram quantities of pure protein

    • Detergent screening to identify optimal solubilization conditions

    • Lipidic cubic phase crystallization trials for membrane proteins

    • Molecular replacement using related UPF0365 family proteins as search models

  • Cryo-EM approach:

    • Reconstitution into nanodiscs or amphipols to maintain native conformation

    • Negative staining to assess sample quality

    • Optimization of freezing conditions

    • Collection of high-resolution data on direct electron detectors

  • Solution NMR studies for dynamic regions:

    • Expression of isotope-labeled protein (15N, 13C)

    • Detergent micelle optimization

    • Assignment of backbone and side-chain resonances

    • Relaxation dispersion experiments to capture dynamics

  • Computational structure prediction:

    • Homology modeling using related UPF0365 family proteins

    • Molecular dynamics simulations to study membrane integration

    • Docking studies with potential interaction partners

Each approach requires specific considerations for membrane proteins, including detergent selection and stability optimization throughout the purification process .

What methodologies are appropriate for investigating potential RNA-binding properties of BH1357?

If investigating potential RNA-binding properties of BH1357, employ these methodologies:

  • RNA binding prediction:

    • Computational analysis for RNA-binding domains or motifs

    • Sequence comparison with known RNA-binding proteins

  • In vitro binding assays:

    • RNA electrophoretic mobility shift assays (EMSA)

    • Filter binding assays with radiolabeled RNA

    • Fluorescence anisotropy with fluorescently labeled RNA

  • Cell-free functional assays:

    • Adapted deadenylation assays using cytoplasmic extracts and in vitro-transcribed, radiolabeled RNA probes

    • Analysis of binding specificity using different RNA sequences

  • Cross-linking studies:

    • UV cross-linking followed by immunoprecipitation

    • PAR-CLIP (Photoactivatable Ribonucleoside-Enhanced Crosslinking and Immunoprecipitation)

For cell-free assay development, consider adapting the HEK293 cell-extract deadenylation assay methodology, which provides a template for investigating protein-RNA interactions in a controlled environment .

How can I address solubility issues when working with the recombinant BH1357 protein?

Addressing solubility challenges with BH1357 requires a systematic approach tailored to membrane proteins:

  • Optimization of expression conditions:

    • Reduce expression temperature (16-25°C)

    • Test induction with varying IPTG concentrations (0.1-1.0 mM)

    • Evaluate specialized E. coli strains designed for membrane proteins (C41, C43)

  • Buffer optimization strategies:

    ComponentRange to TestPurpose
    pH6.5-8.5Find optimal charge state
    NaCl100-500 mMScreen ionic strength
    DetergentsDDM, LDAO, CHAPSSolubilize membrane domains
    StabilizersGlycerol (5-20%), argininePrevent aggregation
    Reducing agentsDTT, TCEP (1-5 mM)Maintain thiol groups
  • Fusion tag strategies:

    • Consider solubility-enhancing tags (MBP, SUMO) in addition to His-tag

    • Test N-terminal vs. C-terminal tag positioning

  • Refolding approaches:

    • Gradually remove denaturants via dialysis

    • Use pulsed refolding with cyclodextrin for detergent removal

    • Implement on-column refolding during purification

  • Fragment-based approach:

    • Identify soluble domains through bioinformatic analysis

    • Express individual domains to determine structure-function relationships

For each optimization step, analyze protein quality using analytical size exclusion chromatography and dynamic light scattering to assess monodispersity .

How can contradictory results in protein interaction studies with BH1357 be reconciled?

Contradictory results in protein interaction studies with BH1357 should be approached methodically:

  • Validation across multiple methods:

    • Confirm interactions using at least three independent methods (e.g., co-IP, pull-down, SPR, FRET)

    • Assess interactions under varying buffer conditions to identify environment-dependent interactions

  • Analysis of experimental variables:

    • Catalog all differences in experimental conditions, including:

      • Protein tags and their positions

      • Buffer compositions

      • Detergent types and concentrations

      • Temperature and incubation times

      • Protein concentration ranges

  • Investigation of protein state:

    • Verify protein folding using circular dichroism

    • Assess oligomerization state using analytical ultracentrifugation

    • Confirm post-translational modifications using mass spectrometry

  • Context-dependent interactions:

    • Test interactions in the presence of potential cofactors or binding partners

    • Evaluate the impact of membrane mimetics (nanodiscs, liposomes)

    • Assess pH and ion dependence of interactions

  • Systematic reporting:

    • Document all experimental conditions in standardized formats

    • Include negative results to build a comprehensive interaction profile

    • Develop a decision tree for resolving contradictions based on reliability hierarchies of methods

This structured approach helps distinguish genuine biological complexity from technical artifacts, particularly important for membrane proteins like BH1357 that may exhibit context-dependent interactions .

What statistical approaches are most appropriate for analyzing experimental data involving BH1357?

When analyzing experimental data involving BH1357, select statistical approaches based on experimental design and data characteristics:

  • For comparative studies:

    • t-tests for simple two-group comparisons (parametric data)

    • Mann-Whitney U tests for non-parametric data

    • ANOVA with appropriate post-hoc tests for multi-group comparisons

    • Use paired tests when samples serve as their own controls

  • For dose-response or time-course experiments:

    • Regression analysis (linear, non-linear)

    • Area under curve (AUC) analysis

    • Mixed-effects models for repeated measures

  • For binding and interaction studies:

    • Non-linear regression for binding curves (Hill equation, Michaelis-Menten)

    • Scatchard or Lineweaver-Burk plots for linearity assessment

    • Statistical comparison of derived parameters (Kd, Bmax)

  • For omics-scale data:

    • Multiple testing correction (FDR, Bonferroni)

    • Enrichment analysis for pathway or functional categorization

    • Dimensionality reduction techniques (PCA, t-SNE)

  • Experimental design considerations:

    • A priori power analysis to determine appropriate sample sizes

    • Randomization and blinding protocols

    • Technical vs. biological replication planning

When designing experiments with BH1357, balance bias and variance by implementing careful measurement protocols. Consider using repeated measures designs where each subject serves as their own control to increase statistical power, particularly for experiments with technical limitations or high variability .

How can I determine if observed phenotypic changes are specifically attributed to BH1357 function?

Establishing causality between BH1357 and observed phenotypes requires multiple lines of evidence:

  • Genetic manipulation approaches:

    • Generate clean knockout mutants using CRISPR-Cas9 or homologous recombination

    • Create conditional/inducible expression systems to control BH1357 levels

    • Perform complementation studies with wild-type and mutant versions

    • Use site-directed mutagenesis to map functional domains

  • Dose-dependency assessment:

    • Establish correlation between BH1357 expression level and phenotype intensity

    • Use titratable expression systems to generate dose-response curves

    • Analyze partial loss-of-function mutants

  • Specificity controls:

    • Knockout/overexpress related proteins to demonstrate specificity

    • Rescue experiments with chimeric proteins to map functional domains

    • Test cross-species complementation with homologs

  • Temporal dynamics:

    • Use time-course experiments with inducible systems

    • Implement protein degradation tags for rapid depletion

    • Correlate protein activity timing with phenotype onset

  • Mechanistic validation:

    • Demonstrate biochemical activity in vitro that explains the observed phenotype

    • Identify and validate downstream effectors

    • Use specific inhibitors if available

For membrane proteins like BH1357, additional considerations include ensuring proper localization of mutant versions and controlling for potential pleiotropic effects of membrane disruption .

How can interdisciplinary collaboration enhance functional characterization of BH1357?

Effective characterization of BH1357 benefits from interdisciplinary collaboration through:

  • Structural biology integration:

    • Crystallographers and cryo-EM specialists for high-resolution structure determination

    • NMR spectroscopists for dynamic studies and ligand binding

    • Computational biologists for molecular dynamics and structure prediction

  • Systems biology approaches:

    • Transcriptomics to identify co-regulated genes

    • Proteomics for interaction networks and post-translational modifications

    • Metabolomics to identify pathway perturbations in knockout strains

  • Evolutionary biology perspectives:

    • Comparative genomics across Bacillus species

    • Phylogenetic analysis of UPF0365 family proteins

    • Evolutionary rate analysis to identify functional constraints

  • Microbiology and cellular biology integration:

    • Phenotypic characterization under diverse environmental conditions

    • Cell imaging for localization and dynamics

    • Specialized growth assays for functional assessment

  • Collaborative workflow implementation:

    • Standardized material transfer protocols

    • Shared electronic lab notebooks

    • Regular interdisciplinary meetings

    • Integration of diverse methodological expertise

This collaborative model accelerates progress through parallel investigation streams and complementary expertise, particularly valuable for proteins like BH1357 where individual approaches might yield limited insights .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.