Recombinant Bacillus halodurans UPF0421 protein BH2644 (BH2644)

Shipped with Ice Packs
In Stock

Description

Protein Overview

BH2644 is a 354-amino acid protein encoded by the BH2644 gene in B. halodurans. It belongs to the UPF0421 family of proteins, which are conserved across bacterial species but have poorly characterized functions . Key features include:

PropertyDetails
UniProt IDQ9K9K2
Molecular Weight~39 kDa (calculated)
TagN-terminal His-tag
Expression SystemE. coli
Purity>90% (SDS-PAGE)

Production and Purification

The protein is expressed in E. coli and purified via affinity chromatography using its His-tag. Critical steps include:

  • Expression Vector: Optimized for high-yield production in E. coli .

  • Purification: Immobilized metal ion affinity chromatography (IMAC) .

  • Formulation: Lyophilized powder or liquid in Tris/PBS-based buffer with 6% trehalose or 50% glycerol .

Reconstitution Guidelines:

  • Lyophilized protein is reconstituted in sterile deionized water to 0.1–1.0 mg/mL .

  • Glycerol (5–50%) is added for long-term storage .

Applications in Research

BH2644 is primarily used in:

  • ELISA Development: Commercial ELISA kits utilize this protein for antibody detection .

  • Functional Studies: Investigating its role in bacterial physiology, particularly in alkaliphilic adaptations .

  • Protein-Protein Interaction Screens: Identified as a candidate for interactome studies in Bacillus species .

Research Limitations and Future Directions

  • Functional Characterization: The biological role of BH2644 remains unclear, necessitating studies on its enzymatic activity or regulatory functions .

  • Structural Biology: Cryo-EM or X-ray crystallography could elucidate its mechanism.

  • Industrial Relevance: Potential applications in biotechnology due to B. halodurans' extremophile traits .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchase method and location. Please consult your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, but this can be adjusted according to your needs.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
BH2644; UPF0421 protein BH2644
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-354
Protein Length
full length protein
Species
Bacillus halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125)
Target Names
BH2644
Target Protein Sequence
MEISGFMKHPWIGRRVLKTGLAVCLTTAICMAFNLSPTFAVISAIVTTEPTAADSLKKGL IRLPAAALGAFFAVLSAYFFGQTPITYAIVSMITIAVCARLRLDAGTLVATLTAVAMIPS TTDHLFADYVSRVAGTSLGIMISTFVNFMILPPKFGPILMNKVEKMFAMLSSELKLVTTK VVDFEKEETMTSYRTLHHHLSETYKLTTFQHDEWKYRKSSSSEKRSFTYLHRKLDYVYKA LAHLGKIGQIRLKKPLSVKERQLVLSFLVSLTNILQDPLHQIHTEHYALARQLEDAMHKK KDATEPIHRLLSELISLHDLTVELEQCTADERRFSLEERAYPSYIFLERLRPSD
Uniprot No.

Target Background

Database Links

KEGG: bha:BH2644

STRING: 272558.BH2644

Protein Families
UPF0421 family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is Bacillus halodurans UPF0421 protein BH2644?

BH2644 is a protein classified as UPF0421 (Uncharacterized Protein Family 0421) encoded by the Bacillus halodurans strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125 genome. It is a full-length protein consisting of 354 amino acids with UniProt accession number Q9K9K2 . The protein is part of the broader research focus on alkaliphilic bacteria, as Bacillus halodurans is known to thrive in high pH environments (up to pH 12), making it relevant for studies on extremophile biology and potential biotechnological applications .

What expression systems are recommended for recombinant BH2644 production?

E. coli expression systems have been successfully employed for the recombinant production of BH2644 . When designing expression constructs, researchers should consider incorporating affinity tags (such as His-tag) to facilitate purification procedures . The expression parameters, including induction conditions, temperature, and media composition, should be optimized to maximize protein yield while maintaining proper folding. For functional studies, it may be necessary to evaluate whether post-translational modifications present in the native protein are critical for activity and choose expression systems accordingly.

What are the optimal storage and handling conditions for recombinant BH2644?

Recombinant BH2644 protein should be stored at -20°C for regular use, or at -80°C for extended storage periods . The protein is typically supplied in a Tris-based buffer containing 50% glycerol, which is optimized for stability . To maintain protein integrity, it is crucial to avoid repeated freeze-thaw cycles. Working aliquots can be stored at 4°C for up to one week . For experimental work requiring longer bench time, prepare fresh working dilutions and maintain temperature control to minimize degradation.

What analytical methods are recommended for assessing BH2644 purity and integrity?

For quality assessment of recombinant BH2644, a multi-analytical approach is recommended. SDS-PAGE with Coomassie staining can evaluate protein purity, with commercial preparations typically exceeding 85% purity . Western blotting with antibodies against the protein or tag can confirm identity. Size-exclusion chromatography can detect aggregation states, while mass spectrometry provides precise molecular weight determination and identification of potential post-translational modifications. For functional integrity, circular dichroism spectroscopy can assess secondary structure content, particularly important when comparing different batches or storage conditions.

How can I design experiments to investigate the potential function of BH2644?

Given the limited functional annotation of BH2644, a systematic approach is recommended. Begin with bioinformatic analysis using tools like BLAST, Pfam, and STRING to identify potential homologs or interacting partners. Conduct gene knockout or knockdown studies in Bacillus halodurans to observe phenotypic changes. Employ protein localization techniques (GFP fusion, immunofluorescence) to determine subcellular distribution, which may provide functional clues. Perform pull-down assays followed by mass spectrometry to identify interacting proteins. Consider transcriptomic analysis comparing wild-type and BH2644-depleted strains under various conditions, particularly alkaline stress given the alkaliphilic nature of B. halodurans .

What approaches can be used to study the membrane association of BH2644?

Based on its amino acid sequence containing hydrophobic regions characteristic of membrane proteins, BH2644 may be membrane-associated . To investigate this, researchers should employ multiple complementary approaches. Membrane fractionation followed by Western blotting can determine whether BH2644 associates with membranes. Fluorescence microscopy using GFP-tagged BH2644 can visualize its cellular localization. Membrane topology can be examined using protease protection assays or reporter fusion proteins. For more detailed analysis, techniques such as solid-state NMR or cryo-electron microscopy may be employed to characterize protein-membrane interactions at the molecular level.

How does BH2644 compare to homologous proteins in other alkaliphilic bacteria?

Comparative genomic analysis reveals that BH2644 belongs to the UPF0421 family, with potential homologs in other Bacillus species. When examining alkaliphilic bacteria, researchers should perform sequence alignment and phylogenetic analysis to identify conserved domains and evolutionary relationships. Functional complementation studies, where the BH2644 gene is expressed in other species lacking the homologous gene, can determine functional conservation. Structural comparisons through homology modeling may provide insights into conserved functional elements. Additionally, comparing expression patterns of homologous genes under various pH conditions may reveal their roles in alkaline adaptation mechanisms.

What techniques are recommended for studying the potential role of BH2644 in alkaline adaptation?

Given that Bacillus halodurans is an alkaliphilic bacterium capable of growing at pH values as high as 12 , BH2644 may contribute to alkaline adaptation. To investigate this, researchers should conduct gene expression analyses comparing BH2644 levels under various pH conditions. Generate knockout mutants and assess their growth and survival at different pH values. Perform protein stability and activity assays across pH ranges to determine if BH2644 exhibits enhanced functionality in alkaline environments. Investigate potential roles in maintaining membrane integrity, ion homeostasis, or pH sensing through targeted biochemical assays. Compare results with other alkaliphilic bacteria to identify conserved adaptation mechanisms.

How might BH2644 relate to the protease activity of Bacillus halodurans?

Bacillus halodurans is known for producing alkaline proteases with significant stability at high pH values . While direct evidence linking BH2644 to protease activity is limited, researchers should investigate potential regulatory roles. Design experiments to determine if BH2644 expression correlates with protease production under different conditions. Use co-immunoprecipitation to test for physical interactions between BH2644 and known proteases or their regulators. Conduct comparative proteomics between wild-type and BH2644 knockout strains, focusing on changes in protease expression. Investigate whether BH2644 affects cellular responses to protein misfolding, which might indirectly influence protease regulation.

What are potential applications of BH2644 research in biotechnology?

Understanding BH2644 function may contribute to several biotechnological applications, particularly those requiring proteins stable in alkaline conditions. If BH2644 contributes to alkaline adaptation, insights from its study could inform the engineering of industrial enzymes with enhanced alkaline stability. Potential applications include detergent formulations, textile processing, and bioremediation of alkaline industrial waste. Additionally, if BH2644 plays a role in membrane integrity under extreme conditions, this knowledge could contribute to the development of robust cell factories for biotechnological processes in challenging environments.

How can contradictory experimental results regarding BH2644 function be reconciled?

When faced with contradictory data about BH2644 function, implement a systematic troubleshooting approach. First, examine differences in experimental conditions, particularly pH, temperature, and buffer composition, which may significantly affect protein behavior. Verify protein integrity using multiple analytical methods to ensure that observed functional differences are not due to protein degradation or misfolding. Consider strain-specific variations that might affect BH2644 function or regulation. Employ multiple orthogonal techniques to assess the same functional aspect, as methodological biases can lead to apparently contradictory results. Finally, consider that BH2644 may have multiple functions depending on cellular context, explaining seemingly contradictory observations.

What systems biology approaches can enhance our understanding of BH2644?

To comprehensively understand BH2644's role in Bacillus halodurans physiology, integrate multiple omics approaches. Combine transcriptomics, proteomics, and metabolomics data from wild-type and BH2644 mutant strains under various conditions, particularly focusing on alkaline stress responses. Apply network analysis to identify functional modules associated with BH2644. Employ flux balance analysis to determine if BH2644 affects metabolic pathways. Use statistical modeling to identify conditions where BH2644 expression is most critical. These integrative approaches can reveal functional associations not apparent from individual experiments and place BH2644 within the broader context of cellular physiology.

How can structural biology techniques advance our understanding of BH2644?

Advanced structural biology techniques can provide crucial insights into BH2644 function. X-ray crystallography or cryo-electron microscopy can determine the three-dimensional structure, potentially revealing functional domains and interaction surfaces. NMR spectroscopy can characterize protein dynamics and identify regions involved in ligand binding or conformational changes. Hydrogen-deuterium exchange mass spectrometry can map structural changes under different conditions, such as varying pH levels, providing clues about adaptation mechanisms. Computational approaches like molecular dynamics simulations can predict structural behavior in different environments, particularly relevant for understanding function in alkaline conditions.

What CRISPR-based approaches can be applied to study BH2644 in Bacillus halodurans?

CRISPR-Cas systems offer powerful tools for investigating BH2644 function in its native context. Develop CRISPR interference (CRISPRi) systems optimized for Bacillus halodurans to achieve tunable repression of BH2644 expression, allowing assessment of dose-dependent phenotypes. Employ CRISPR-Cas9 for precise genomic modifications, including the introduction of fluorescent tags for localization studies or specific mutations to test functional hypotheses. Design CRISPR-based screens to identify genetic interactions by combining BH2644 modification with a genome-wide library of guide RNAs. These approaches can overcome traditional challenges in genetic manipulation of non-model bacteria and provide unprecedented insights into BH2644 function.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.